DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and pbx1b

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_021332595.1 Gene:pbx1b / 570960 ZFINID:ZDB-GENE-070424-11 Length:433 Species:Danio rerio


Alignment Length:57 Identity:27/57 - (47%)
Similarity:40/57 - (70%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422
            ::||..|.|.||.||..:.:.||::|||||:.|::||:...:|:.||:|||.|.|.|
Zfish   237 RRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 18/37 (49%)
pbx1bXP_021332595.1 PBC 41..235 CDD:461052
homeodomain 237..297 CDD:238039 27/57 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.