DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12e1 and cyp11a1

Sequence 1:NP_650003.4 Gene:Cyp12e1 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_694485.2 Gene:cyp11a1 ZFINID:ZDB-GENE-010306-1 Length:509 Species:Danio rerio

Alignment Length:545 Identity:141/546 (26%)
Similarity:238/546 (44%) Gaps:87/546 (16%)


  Fly     5 QWNAN-KQISRQIYQLCRGLAQKAT----AVNLEEAKPYADIPG--PSKLQLIRAFLPGGLYKNL 62
            :||.. .::.:.:..|...|..|.|    |......:|:..|||  .:.|..:.||...|..:| 
Zfish     3 RWNVTFARLDQSLSSLKNLLQVKVTRSGRAPQNSTVQPFNKIPGRWRNSLLSVLAFTKMGGLRN- 66

  Fly    63 PVHEMFLDMNRQYGSIFRMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRRE 127
             ||.:.:...:.:|.|:| ..|...|.|..:.|:|..::|:.||.:|.|.:.:....: |.:|.:
Zfish    67 -VHRIMVHNFKTFGPIYR-EKVGIYDSVYIIKPEDGAILFKAEGHHPNRINVDAWTAY-RDYRNQ 128

  Fly   128 VFDGYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERI-RIIRDPVTQEMPD 191
            .:    |:....|.||...|..:|..||.|:....::..|.:|..:|:.|: :.|.....::...
Zfish   129 KY----GVLLKEGKAWKTDRMILNKELLLPKLQGTFVPLLEEVGQDFVARVNKQIERSGQKQWTT 189

  Fly   192 DFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQ--LDIMPAFWK--- 251
            |...|:....:||:.:|.....|||                |.|.::..||  :|.:...:|   
Zfish   190 DLTHDLFKFSLESVSAVLYGERLGL----------------LLDNIDPEFQHFIDCVSVMFKTTS 238

  Fly   252 ---YLPMPNFKKLMRSL------------DTITDFCYFHIGNALKRIEEDAKAGTLNEIGLETSL 301
               ||| |.   |:||:            |.|.:....:|.|..|:.:|:.: |.....|:...|
Zfish   239 PMLYLP-PG---LLRSIGSNIWKNHVEAWDGIFNQADRYIQNIFKQWKENPE-GNGKYPGVLAIL 298

  Fly   302 L--EKLARFDRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEI-------RGIL 357
            |  :||:..|.:.:|   .:|:..|.|....||...|:.|::.||.|..|..||       :|.:
Zfish   299 LMQDKLSIEDIKASV---TELMAGGVDSVTFTLLWTLYELARQPDLQDELRAEISAARIAFKGDM 360

  Fly   358 PNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGTDVGIAANYQMA 422
                    ::.::.:|.|:|.:||.:|::|:.....|.:..|.|:..|.:.|||.|.:.. |.|.
Zfish   361 --------VQMVKMIPLLKAALKETLRLHPVAMSLPRFITEDTVIQNYHIPAGTLVQLGV-YAMG 416

  Fly   423 NMEQFVPKVREFIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVR 487
            ...||.||..::.|.||:..:...         |..|.||||||.|.|:||.:..::|.:..::.
Zfish   417 RDHQFFPKPEQYCPSRWISSKRQY---------FKSLGFGFGPRQCLGRRIAETEMQIFLIHMLE 472

  Fly   488 NFKIGFDYPIENAFKAQFFVQPNIP 512
            ||:|.....||...|.:..:.|..|
Zfish   473 NFRIEKQKQIEVRSKFELLLMPEKP 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 125/481 (26%)
cyp11a1NP_694485.2 p450 66..502 CDD:278495 126/483 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.