DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12e1 and cyp27a1.2

Sequence 1:NP_650003.4 Gene:Cyp12e1 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_001334004.3 Gene:cyp27a1.2 ZFINID:ZDB-GENE-081104-511 Length:522 Species:Danio rerio

Alignment Length:536 Identity:145/537 (27%)
Similarity:250/537 (47%) Gaps:78/537 (15%)


  Fly    21 RGLAQKATAVNL------EEAKPYADIPGPSKLQLIRAFLPGGLYKNLPVHEMFLDMNRQYGSIF 79
            |..|..|.|.::      .:.|..||:|......::...|..| |.| .|||:.|...:.||.::
Zfish    28 RSAAGNAAAASVSVQDGHRKLKTEADLPEIKIFTMLYQMLFKG-YLN-SVHELQLYQKQVYGPLW 90

  Fly    80 RMP-------SVAGTDLVLTMNPQDYEVIFRNEGQYPYR---------RSFEVMDYFKRVHRREV 128
            ::.       |::..:|:        |.:.|.:.:||.|         |....:.|         
Zfish    91 KINAGNLQGISISSVELL--------EELLRKDEKYPCRGYMTLWTEHRDLRGISY--------- 138

  Fly   129 FDGYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIRD-PVTQEMPDD 192
                 |..:..|..|.|:|..:|..:|.|:::..|...:..|..:|::||..:|: ..|.::..:
Zfish   139 -----GPFTEEGEKWYKLRAVLNKRMLHPKDSVQYGDVVNAVITDFIKRIYYLREMSPTGDLVSN 198

  Fly   193 FAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQLDIMPAFW--KYLPM 255
            ...::....:|.|.|:...|.:|.| |:....:.||.:..:..:......:.::|. |  ||.|.
Zfish   199 LTNELYRFSLEGIASILFETRIGCL-EKEIPAETQKFINFIAQMFTYSMHVALLPN-WTRKYFPF 261

  Fly   256 PNFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTLNEIGLE--TSLLE--KLARFDRQTAVII 316
              ::|.:...|.|..|....|...::.|::  :..|..::..|  |.||.  |::|.|...:|  
Zfish   262 --WQKYIDGWDGIFKFGTKMIDMKMEAIQK--RVDTNQDVAGEYLTYLLSNGKISRKDVYGSV-- 320

  Fly   317 AMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSL-TIENMRNLPYLRACIK 380
             .:||.||.|.|..|:...|:.|||.|:.|..|.:|:..:|  ||..: |.|.:.::|:|:|.||
Zfish   321 -SELLLAGVDSTSNTMLWALYLLSKDPEAQETLYQEVTKVL--KDDRIPTAEEVNSMPFLKAVIK 382

  Fly   381 EGIRMYPIGPGTLRRMPH-DVVLSGYRVVAGTDVGIAANYQMANMEQFVPKVREFIPERWLRDES 444
            |.:|:||:.|...|.:.. :||:..|.....|...: .:|.::..|:..|:.::|.|||||||  
Zfish   383 ETLRLYPVVPVNSRLIAETEVVIGEYFFPKKTTFTL-CHYVISRDEKVFPEPQKFKPERWLRD-- 444

  Fly   445 NSHLVGET-ATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKIGFDYPIENAFKAQF--F 506
                 |.| ..||..:|||||.|:|.|:||.::.:.:|::||::.|::..| |.....||.|  .
Zfish   445 -----GRTRPNPFGSIPFGFGVRACVGRRIAELEMHLALARLIKLFEMRPD-PTVGEVKANFRSV 503

  Fly   507 VQPNIPFKFKFIERNE 522
            :.||......|:||.:
Zfish   504 LVPNKKVNLHFVERQK 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 130/482 (27%)
cyp27a1.2XP_001334004.3 p450 66..505 CDD:278495 132/483 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.