DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12e1 and si:ch211-113j14.1

Sequence 1:NP_650003.4 Gene:Cyp12e1 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_686522.4 Gene:si:ch211-113j14.1 ZFINID:ZDB-GENE-120215-110 Length:573 Species:Danio rerio

Alignment Length:547 Identity:150/548 (27%)
Similarity:253/548 (46%) Gaps:77/548 (14%)


  Fly    11 QISRQI--YQ--LCRGLAQKATAVNLEEA-------KPYADIPGPSKLQLIR-AFLPGGLYKNLP 63
            ||.|:.  :|  :.|.|..:...|:|:.|       |...|:|||:....:. .|:.|...|:  
Zfish    66 QIGRKYAPFQEMIARTLKSQTGDVDLQSANTITGRYKTKDDLPGPNLATTVYWLFVKGYADKS-- 128

  Fly    64 VHEMFLDMNRQYGSIFR-------MPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFK 121
             |.|.::..|.||.|:|       :.:|||.||:..        :.|.||:||.|....      
Zfish   129 -HAMQVEHKRLYGPIWRSRFGPFDVINVAGADLIAQ--------VIRQEGRYPVRTDLP------ 178

  Fly   122 RVHRREVFD----GYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIR 182
              |.||..|    .| |:....||.|.::|:|:||.:|:.:....|...:.:|..:.|:|:.::|
Zfish   179 --HWREYRDMRGQAY-GIHVDTGPEWYRIRSALNPKMLKLKEVTAYAPIIHEVVSDLLQRLELLR 240

  Fly   183 ----DPVTQEMPDDFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQL 243
                |.:|   ..|.|.::.....|.|.|:...|.||.|.|:... |..:.:.|:.:::.|...:
Zfish   241 LRSPDQIT---VSDLASELYKFGFEGISSILFETRLGCLQEEIPT-DTLRFISAVNEMLALSETV 301

  Fly   244 DIMPAFWKYLPMPNFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTLNEIGLETSLLEKLARF 308
            ...|.:.::: .|.:|:.:::.|.:.|.....|...:..|.:....|...| |:..:.|....:.
Zfish   302 LFFPRWTRHI-FPFWKRFVQAWDELYDVARHLIDKKVNEIRDQVARGEEVE-GMYLTYLLSSNKL 364

  Fly   309 DRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSLTIENMRNLP 373
            ......|...:||..|.|.|..||...|:.|:::|:.|.||..||..:.|||....| :::..:|
Zfish   365 SLGEVYISLTELLLGGVDTTSNTLSWTLYHLARNPEIQKRLHNEIVSVCPNKKVPNT-DDLTKMP 428

  Fly   374 YLRACIKEGIRMYPIGPGTLR-RMPHDVVLSGYRVVAGTDVGIAANYQMANMEQFVPKVREFIPE 437
            |::|.|||.:||||:.||..| .:..|:|:..|.....|...: .:|.:::.|...|....|:||
Zfish   429 YMKAVIKEILRMYPVVPGNGRLTVDSDIVVDNYWFPKKTQFHL-CHYAVSHDENNFPDAERFVPE 492

  Fly   438 RWLRD---ESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKIGFD----- 494
            ||:||   .|..|       |:..:|||.|.|:|.|||:.::.:..|:|||::.:::...     
Zfish   493 RWIRDSPSRSQHH-------PYSSVPFGVGVRACVGKRVAELEMYFALSRLMQQYEVRTKAGSPS 550

  Fly   495 -YPIENAFKAQFFVQPNIPFKFKFIER 520
             .|     |.:..:.|:.|...:||.|
Zfish   551 IQP-----KTRTLLIPSQPIDLQFIPR 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 130/479 (27%)
si:ch211-113j14.1XP_686522.4 p450 108..569 CDD:278495 136/501 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.