DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12e1 and Cyp11b2

Sequence 1:NP_650003.4 Gene:Cyp12e1 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_036670.2 Gene:Cyp11b2 RGDID:2454 Length:502 Species:Rattus norvegicus

Alignment Length:543 Identity:134/544 (25%)
Similarity:233/544 (43%) Gaps:94/544 (17%)


  Fly     2 LSTQWNANKQISRQIYQLCRGLAQKATAVNLEEAKPYADIPGPSK------LQLIRAFLPGGLYK 60
            |:..|        |.....|.|...||... :..||:..||..|:      :|::|.  .|....
  Rat    13 LARPW--------QCLHRTRALGTTATLAP-KTLKPFEAIPQYSRNKWLKMIQILRE--QGQENL 66

  Fly    61 NLPVHEMFLDMNRQYGSIFRMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHR 125
            :|.:|:.|    ::.|.||| .|..|..:|..|.|:|.|.:.:.|...|.|...|..     |..
  Rat    67 HLEMHQAF----QELGPIFR-HSAGGAQIVSVMLPEDAEKLHQVESILPRRMHLEPW-----VAH 121

  Fly   126 REVFDGYDGLTSG----NGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIRDPVT 186
            ||:    .||..|    ||..|...|..:||.:|.|:..:.::..:.:|:.:|||   .::..|.
  Rat   122 REL----RGLRRGVFLLNGADWRFNRLKLNPNVLSPKAVQNFVPMVDEVARDFLE---ALKKKVR 179

  Fly   187 QEMPDDFAVDIR----HLVIESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQLDIMP 247
            |.......:|::    :..||:.........|||||...|...: |.:.||..:.:...||..:|
  Rat   180 QNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLNPGSL-KFIHALHSMFKSTTQLLFLP 243

  Fly   248 -AFWKYLPMPNFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTLNEI-GLETSLLEKLARFDR 310
             :..::.....:|:...:.|.|:::.    ...:.::.::.:.|:.... |:..:|:       .
  Rat   244 RSLTRWTSTRVWKEHFDAWDVISEYA----NRCIWKVHQELRLGSSQTYSGIVAALI-------T 297

  Fly   311 QTAVII------AMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEI----RGILPNKDSSLT 365
            |.|:.:      :|:|.....|.|.:.|...||.|:::||.|..|.:|.    ..|..|...:  
  Rat   298 QGALPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQQALRQETLAAEASIAANPQKA-- 360

  Fly   366 IENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGTDVGIAANYQMANMEQFVPK 430
               |.:||.|||.:||.:|:||:|....|.:..|:||..|.|.|||.| :...|.|.......|:
  Rat   361 ---MSDLPLLRAALKETLRLYPVGGFLERILNSDLVLQNYHVPAGTLV-LLYLYSMGRNPAVFPR 421

  Fly   431 VREFIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKIGFDY 495
            ...::|:|||          |....|.:|.||||.|.|.|:|:.::.:.:.:..:::.|::    
  Rat   422 PERYMPQRWL----------ERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTFQV---- 472

  Fly   496 PIENAFKAQFFVQPNIPFKFKFI 518
                    :...|.::...::|:
  Rat   473 --------ETLRQEDVQMAYRFV 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 117/474 (25%)
Cyp11b2NP_036670.2 p450 44..498 CDD:278495 124/504 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.