DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and AT1G72090

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_565035.1 Gene:AT1G72090 AraportID:AT1G72090 Length:601 Species:Arabidopsis thaliana

Alignment Length:526 Identity:128/527 (24%)
Similarity:225/527 (43%) Gaps:94/527 (18%)


  Fly    53 PGFQ---DFFAVKPASRLKTDEEEHVDTSVPYLN----------SIDFNGNGRKVHFEVYGCQMN 104
            |||:   :...:.|    ||::.:.:.:....:.          |:...|. :.::.:.:||..|
plant    17 PGFRLPLNAVGINP----KTNKSKRISSKPDQITASNRDSLAPPSMKIPGT-QTIYIKTFGCSHN 76

  Fly   105 TNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTRRHPLQ 169
            .:|:|.:...|...||...:.|||||:.::.||.|:..::..:...:...|:.|.         .
plant    77 QSDSEYMAGQLSAFGYALTEVPEEADLWLINTCTVKSPSQSAMSTLITRGRSGKK---------P 132

  Fly   170 LTLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAI-SRHYGNSAINVLLSLDETYADVMP 233
            |.:.||:.:..::  |::.:.|.|:    ..:.:.|::.| ........:.:|........|:..
plant   133 LVIAGCVPQGSRD--LKELEGVSVV----GVQQIDRVVEIVEETLKGHEVRLLTRKTLPALDLPK 191

  Fly   234 VRLNSESPTAFVSIMR---GCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQ 295
            ||.|:     |:.|:.   ||...||||.....||...|..:.|:|..|:.:..:||||:.|..:
plant   192 VRRNN-----FIEILPINVGCLGACTYCKTKHARGHLGSYTVDSLVERVRTVISEGVKEIWLSSE 251

  Fly   296 NVNSY-RDRTAQEEQDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPD-----MRIRFTSP 354
            :..:| ||.                          |.....||.::.:.:|.     :||..|:|
plant   252 DTGAYGRDI--------------------------GVNLPILLNAIVKELPSDQSTMLRIGMTNP 290

  Fly   355 -----HPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPN 414
                 |.|    |:..|:| ||.|...||:|.|||:..||..|.|.|:...:..:|..:.:.:|.
plant   291 PFILEHLK----EIAAVLR-HPCVYTFLHVPVQSGSDSVLTAMNREYTASEFRTVVDTLTELVPG 350

  Fly   415 VGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQ 479
            :.:::|.||||.|||:|:|..||.||:..::...::..:..|..|.|.:..|  |...:..:|.:
plant   351 MQIATDIICGFPGETDEDFSQTVELIKDYKFPQVHISQFYPRPGTPAAKMKK--VQSKIVKQRSR 413

  Fly   480 RMVQVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPIS--GDSTAR 542
            .:..||...|.  :..||.:|:.|.|. :......|..|.....::|:|..   |.|  |.|...
plant   414 ELTSVFEAFAP--YTGMECREERIWIT-EVATDGIHLVGHTKGYVQVLVTG---PESMLGTSAMA 472

  Fly   543 KSFGVG 548
            :...||
plant   473 RITSVG 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 121/479 (25%)
UPF0004 93..196 CDD:279287 24/103 (23%)
TRAM 494..568 CDD:280171 15/58 (26%)
AT1G72090NP_565035.1 UPF0004 65..156 CDD:279287 24/106 (23%)
MiaB-like-B 66..487 CDD:273703 120/473 (25%)
Radical_SAM 201..406 CDD:100105 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D835984at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126807
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.