DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and AT4G36390

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_195357.2 Gene:AT4G36390 AraportID:AT4G36390 Length:640 Species:Arabidopsis thaliana

Alignment Length:594 Identity:276/595 (46%)
Similarity:377/595 (63%) Gaps:39/595 (7%)


  Fly    14 HASTTAS-------KGATTSVTSSAAGQLK--SEPAARATFLERIQR-----GPGFQDFFAVKPA 64
            |||:::|       :.:|..:|.....:.|  |...:|:..:.:|..     ||....|.:...|
plant    42 HASSSSSSALLPRCRSSTHRLTQKPINRKKGFSLNLSRSFSISQIASSGKFDGPSLHQFVSNAQA 106

  Fly    65 -SRLKTDEEEHVDTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLR-CQEPE 127
             :.|.|.|.|...|    |:| |....|| ::.|.||||||.||.|:|.:|:|.:||.. ..:||
plant   107 HASLTTPETESEST----LDS-DIASKGR-IYHETYGCQMNINDMEIVLAIMKNSGYKEVVTDPE 165

  Fly   128 EADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNK--------RSTRRHPLQLTLLGCMAERLKEKL 184
            .|:||.:.|||:|:.||||:..||.:...:|.:        |:....|.::.:|||||||||:|:
plant   166 SAEVIFVNTCAIRENAEQRVWQRLNYFWFLKREWKVNAATGRAKSLKPPKVVVLGCMAERLKDKI 230

  Fly   185 LEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVLLSLDETYADVMPVRLNSESPTAFVSIMR 249
            |:.::.|||:.|||:|:||||||. ...||...||.||||:|||||:.|||::..|.|||||:||
plant   231 LDSDKMVDVVCGPDAYRDLPRLLE-EVDYGQKGINTLLSLEETYADISPVRISENSITAFVSVMR 294

  Fly   250 GCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQNVNSYRDRTAQEEQDSLKA 314
            ||:|||.:||||||||||||||:.||:.||..|.|.|||||||||||||||.|.:|..|..: ..
plant   295 GCNNMCAFCIVPFTRGRERSRPVESIIREVGELWESGVKEVTLLGQNVNSYNDDSADRESGA-NW 358

  Fly   315 TPVPGFSTVYKPKTGGTPFAALLRSVAQAVPDMRIRFTSPHPKDFSDEVLEVIRDHPNVCKQLHL 379
            ....|||:..|.|..|..||.||..::...|:||.|||||||||:.||:|.::||..|:|..:||
plant   359 EYSEGFSSRCKVKNMGLRFADLLDRLSVEFPEMRFRFTSPHPKDYPDELLYLMRDRHNICNLIHL 423

  Fly   380 PAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQ 444
            ||||||:::||:|||||:|||||:||:.||..:|:|.::||||.|||||||||.|:|:||::.|.
plant   424 PAQSGNSRILEQMRRGYTREAYLDLVKKIRSIIPDVAITSDFITGFCGETEEEHQETLSLVRAVG 488

  Fly   445 YNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFREGATQLHRKMEGQEQLILIEGKS 509
            |::||:|||||||||.|||.|.||||..||..||..::..|||.....:....|..||:|:||.:
plant   489 YDMAYMFAYSMREKTHAHRNYTDDVPEEVKQRRLTELIDAFRETTGPCYDSQVGSTQLVLVEGPN 553

  Fly   510 KRS-DAHWFGRNDANIKV--IVPSIY---VPISGDSTARKSFGVGDFLAVRIEESNSQVLKGTPL 568
            ||: :....|:.|...:|  :...::   ..:.||...|.. |:|||:.|:||:|....|.|..|
plant   554 KRAPETELIGKTDKGHRVSFVTKPLFDKACLLDGDDLKRNP-GIGDFVEVQIEKSTRASLFGEAL 617

  Fly   569 ELSNITDFH 577
            .:|.::.||
plant   618 AISKMSLFH 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 251/497 (51%)
UPF0004 93..196 CDD:279287 47/112 (42%)
TRAM 494..568 CDD:280171 24/80 (30%)
AT4G36390NP_195357.2 PRK14329 130..616 CDD:237676 249/490 (51%)
UPF0004 130..242 CDD:279287 48/113 (42%)
Radical_SAM 294..517 CDD:100105 137/224 (61%)
TRAM 539..617 CDD:280171 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9502
Inparanoid 1 1.050 484 1.000 Inparanoid score I326
OMA 1 1.010
OrthoDB 1 1.010 D835984at2759
OrthoInspector 1 1.000 T193463
orthoMCL 1 0.900 OOG5_126807
Panther 1 1.100 LDO PTHR43020
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.