DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and Cdk5rap1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_080152.1 Gene:Cdk5rap1 MGIID:1914221 Length:588 Species:Mus musculus

Alignment Length:548 Identity:297/549 (54%)
Similarity:392/549 (71%) Gaps:3/549 (1%)


  Fly    18 TASKGATTSVTSSAAGQLKSEPAARATFLERIQRGPGFQDFFAVKPASRLKTDEEEHVDTSVPYL 82
            |....::.|.|...:.:.||..|.: .|..|:..||.||.|.......:.|....| |:...|||
Mouse    27 TCRAQSSVSSTPCPSPEAKSSEAQK-DFSSRLATGPTFQHFLRSASVPQEKPSSPE-VEDPPPYL 89

  Fly    83 NSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRI 147
            :..:..|..|||:.|.||||||.||||:.:|||:::||||....:|||||:||||::|:.|||.|
Mouse    90 SGDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCSIREKAEQTI 154

  Fly   148 RNRLKHLRAMKNKRSTRRHPLQLTLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAISRH 212
            .|||..|:.:|.||...|.||::.:|||||||||.::|.:|:.||::||||:|:|||||||:...
Mouse   155 WNRLHQLKVLKTKRPRSRVPLRIGILGCMAERLKGEILNREKMVDLLAGPDAYRDLPRLLAVVES 219

  Fly   213 YGNSAINVLLSLDETYADVMPVRLNSESPTAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVA 277
             |..|.||||||||||||:|||:.:..:.:|||||||||||||:|||||||||||||||:|||:.
Mouse   220 -GQQAANVLLSLDETYADIMPVQTSPSATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPVASILD 283

  Fly   278 EVKALAEQGVKEVTLLGQNVNSYRDRTAQEEQDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQ 342
            ||:.|:|||:||||||||||||:||.:..:..::..|....||:|.||||.||..|:.||..|::
Mouse   284 EVRKLSEQGLKEVTLLGQNVNSFRDNSEVQFNNAGSANLSRGFTTNYKPKQGGLRFSHLLDQVSR 348

  Fly   343 AVPDMRIRFTSPHPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQH 407
            ..|:|||||||||||||.||||::||:..|:|||:|||||||:::||:.||||||||||:.||.|
Mouse   349 IDPEMRIRFTSPHPKDFPDEVLQLIRERHNICKQIHLPAQSGSSRVLDAMRRGYSREAYVALVHH 413

  Fly   408 IRQFLPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPIN 472
            :|:.:|.|.||||||.|||||||::.:.||||:::||||..:|||||||:||.|:.|.|||||..
Mouse   414 VRETIPGVSLSSDFITGFCGETEDDHRQTVSLLREVQYNTGFLFAYSMRQKTRAYHRLKDDVPEE 478

  Fly   473 VKNERLQRMVQVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISG 537
            ||..||:.::.||||.|::.::...|..||:|:||.||||.....||||||:|||.|...|....
Mouse   479 VKLRRLEELITVFREEASKANKTSVGCSQLVLVEGFSKRSTTDLCGRNDANLKVIFPDAEVEDIT 543

  Fly   538 DSTARKSFGVGDFLAVRIEESNSQVLKG 565
            :...:.....||::.|:|..::||.|||
Mouse   544 NPGLKVRAQPGDYVLVKITSASSQTLKG 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 278/479 (58%)
UPF0004 93..196 CDD:279287 58/103 (56%)
TRAM 494..568 CDD:280171 30/73 (41%)
Cdk5rap1NP_080152.1 PRK14329 87..573 CDD:237676 281/487 (58%)
UPF0004 100..203 CDD:279287 58/103 (56%)
TRAM 500..574 CDD:294784 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 1 1.000
Homologene 1 1.000 H9502
Inparanoid 1 1.050 577 1.000 Inparanoid score I1028
Isobase 1 0.950 0 Normalized mean entropy S2963
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006046
OrthoInspector 1 1.000 T1084196
orthoMCL 1 0.900 OOG5_126807
Panther 1 1.100 LDO PTHR43020
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2454
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.