DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and cdk5rap1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001103849.1 Gene:cdk5rap1 ZFINID:ZDB-GENE-070424-90 Length:577 Species:Danio rerio

Alignment Length:550 Identity:294/550 (53%)
Similarity:392/550 (71%) Gaps:20/550 (4%)


  Fly    37 SEPAARATFLERIQR-------GPGFQDFFAVKPASRLKTD---EEEHVDTSVPYLNSIDFNGNG 91
            :|.::..|.|.||.:       ||.||||.    .|..|:|   .||:.:..:|.    :.:.:.
Zfish    33 TESSSHGTGLSRIMQLKSKLTNGPSFQDFI----MSSDKSDFDGSEEYEEHYIPK----NMSDHS 89

  Fly    92 RKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKHLRA 156
            |||:||.|||||||||||:.:|||::.||.|..|.::|||::||||::|:.|||.|.||||||.|
Zfish    90 RKVYFETYGCQMNTNDTEIAWSILQKAGYSRTLELQKADVVLLVTCSIREKAEQTIWNRLKHLTA 154

  Fly   157 MKNKRSTRRHPLQLTLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVL 221
            .|.:....:..|.:.:|||||||||.:||:||:.|||:||||:|:||||||::: |.|..|.|||
Zfish   155 SKKRIQKHKRSLTIGVLGCMAERLKSELLDQEKLVDVLAGPDAYRDLPRLLSLA-HGGQRASNVL 218

  Fly   222 LSLDETYADVMPVRLNSESPTAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQG 286
            |||:||||||:||....|..:|||||||||||||:|||||||||||||||::|||.||:.|::||
Zfish   219 LSLEETYADVIPVHQTLEGHSAFVSIMRGCDNMCSYCIVPFTRGRERSRPMSSIVEEVRMLSDQG 283

  Fly   287 VKEVTLLGQNVNSYRDRTAQEEQDSLKATPVP-GFSTVYKPKTGGTPFAALLRSVAQAVPDMRIR 350
            |||:||||||||||||.:..:...|.:.|.:. ||.:||:.|.||..||.||..|:...|:||||
Zfish   284 VKEITLLGQNVNSYRDLSKMQFSCSERNTQLSRGFQSVYRTKQGGLRFADLLDRVSLINPNMRIR 348

  Fly   351 FTSPHPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNV 415
            |||||||||.||||::|::..|:||.||||.|||::::|..|||||:||||||||::||:.:|.|
Zfish   349 FTSPHPKDFPDEVLQLIQERSNICKHLHLPVQSGSSRILHAMRRGYTREAYLELVENIRKIIPGV 413

  Fly   416 GLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQR 480
            .||||||.|||.||||:.|.|:||:::|.||:.:.|.||||:||.|:.|.:|:||..||..||:.
Zfish   414 SLSSDFIAGFCSETEEDHQQTISLLKEVGYNIGFFFTYSMRKKTHAYHRLEDNVPAPVKKRRLEE 478

  Fly   481 MVQVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTARKSF 545
            ::.||||.||:::..:.|..||:|:|||||||.....||||.|:|||.|...:|:..:.|.....
Zfish   479 LISVFREKATKVNMTLIGNTQLVLVEGKSKRSSEELCGRNDGNVKVIFPKTNLPVQPEKTQMACI 543

  Fly   546 GVGDFLAVRIEESNSQVLKGTPLELSNITD 575
            ..||::.|:|..:|||.|:|..|..|:..|
Zfish   544 TPGDYVLVKITSANSQSLRGHALNHSSPND 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 275/483 (57%)
UPF0004 93..196 CDD:279287 60/103 (58%)
TRAM 494..568 CDD:280171 31/74 (42%)
cdk5rap1NP_001103849.1 PRK14329 66..567 CDD:237676 280/506 (55%)
UPF0004 91..194 CDD:279287 60/103 (58%)
TRAM 493..566 CDD:280171 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205516620
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9502
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D407532at33208
OrthoFinder 1 1.000 FOG0006046
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126807
Panther 1 1.100 LDO PTHR43020
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.