DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and cdk5rap1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_012827252.1 Gene:cdk5rap1 XenbaseID:XB-GENE-5727595 Length:625 Species:Xenopus tropicalis

Alignment Length:555 Identity:296/556 (53%)
Similarity:394/556 (71%) Gaps:20/556 (4%)


  Fly    26 SVTSSAAGQLKSEPAARATFLERIQRGPGFQDFFA-VKPASRL-KTDEEEHVDTSVPYLNSIDFN 88
            |.|||:...||    .:..|..::..||..:||.. .|||..: .||:|:    ..||:......
 Frog    77 STTSSSKETLK----RKEEFTSKLATGPQLKDFLVNNKPAETVSSTDDED----PPPYIIPSYSP 133

  Fly    89 GNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKH 153
            ....|::.|.||||||.||||:.:|||::|||:|.....|||||:||||:||:.|||.|.|||:.
 Frog   134 SRNNKIYLETYGCQMNVNDTEIAWSILQQNGYVRTYTEAEADVILLVTCSVREKAEQTIWNRLQQ 198

  Fly   154 LRAMKNKRS-TRRHPLQLTLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSA 217
            |.|:|.||| |.|  :::.||||||||||:::|::|..||::||||:|:||||||::: ..|...
 Frog   199 LAALKRKRSKTSR--MRIGLLGCMAERLKQEILDKENLVDLVAGPDAYRDLPRLLSVA-ETGQQV 260

  Fly   218 INVLLSLDETYADVMPVRLNSESPTAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKAL 282
            .|||||:||||||::||..::.|.:||||||||||||||||||||||||||||||.||:.||:.|
 Frog   261 ANVLLSVDETYADILPVHTSASSKSAFVSIMRGCDNMCTYCIVPFTRGRERSRPLQSILEEVRML 325

  Fly   283 AEQGVKEVTLLGQNVNSYRDRTAQEEQDSLKATPVP-GFSTVYKPKTGGTPFAALLRSVAQAVPD 346
            :.|||||||||||||||||| |:..:..:.::.|:. ||||:||.|.||..|..||..|:|..|:
 Frog   326 SSQGVKEVTLLGQNVNSYRD-TSSAQFPNAESPPLSRGFSTIYKHKKGGLRFVDLLDKVSQIDPE 389

  Fly   347 MRIRFTSPHPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQF 411
            |||||||||||||.||||::|.:..|:|||:|:|||||:.:|||.||||||||.||:|:|:|::.
 Frog   390 MRIRFTSPHPKDFPDEVLQLIAERHNICKQIHIPAQSGSNKVLETMRRGYSREVYLDLIQNIQES 454

  Fly   412 LPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNE 476
            :|.|.||||||.|||.||||:...|:||::.|.||.|:|||||||:||.|:.|.:||||..||..
 Frog   455 IPGVSLSSDFITGFCEETEEDHLQTLSLLRTVSYNAAFLFAYSMRKKTRAYHRLQDDVPQEVKQR 519

  Fly   477 RLQRMVQVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVI---VPSIYVPISGD 538
            ||..::.||||.|.:::::..|..||:|:||.||||.....||||.|.|||   .|.: ..::.:
 Frog   520 RLAELIAVFREEAGRVNQRAVGSTQLVLVEGPSKRSPEELCGRNDGNTKVIFSEAPKV-GGLAQE 583

  Fly   539 STARKSFGVGDFLAVRIEESNSQVLKGTPLELSNI 573
            ::.:.....||::.|:|..|:||.||||.|.|:.:
 Frog   584 NSLQNRIQSGDYVLVKITSSSSQSLKGTLLGLTTL 618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 276/487 (57%)
UPF0004 93..196 CDD:279287 60/104 (58%)
TRAM 494..568 CDD:280171 30/77 (39%)
cdk5rap1XP_012827252.1 PRK14329 132..615 CDD:237676 276/488 (57%)
UPF0004 138..240 CDD:279287 60/104 (58%)
TRAM 537..613 CDD:280171 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205516584
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9502
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D407532at33208
OrthoFinder 1 1.000 FOG0006046
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.