DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and CDKAL1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_024302249.1 Gene:CDKAL1 HGNCID:21050 Length:593 Species:Homo sapiens

Alignment Length:507 Identity:123/508 (24%)
Similarity:227/508 (45%) Gaps:96/508 (19%)


  Fly    71 EEEH---VDTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEEADVI 132
            |||:   .|:::|.:         :|:....:||..|.:|.|.:...|...||...:...:||:.
Human    49 EEENSPPSDSTIPGI---------QKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLW 104

  Fly   133 MLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTRRHPLQLTLLGCMAERLKEK----------LLEQ 187
            :|.:|.|::.||...||.:|..:. :||:        :.|.||:.:....:          :.:.
Human   105 LLNSCTVKNPAEDHFRNSIKKAQE-ENKK--------IVLAGCVPQAQPRQDYLKGLSIIGVQQI 160

  Fly   188 EQCVDVIAGPDSYK-DLPRLLAISRHYGNSAINVLLSLDETYADVMPVRLNSESP-TAFVSIMRG 250
            ::.|:|:  .::.| ...|||...:..|.       .|.....|:..:|.|   | ...:||..|
Human   161 DRVVEVV--EETIKGHSVRLLGQKKDNGR-------RLGGARLDLPKIRKN---PLIEIISINTG 213

  Fly   251 CDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQNVNSY-RDRTAQEEQDSLKA 314
            |.|.||||.....||...|.|:..:|...|...::||.|:.|..::..:| ||.           
Human   214 CLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDI----------- 267

  Fly   315 TPVPGFSTVYKPKTGGTPFAALLRSVAQAVPD---MRIRFTS-PHPKDFSDEVLEVIRDHPNVCK 375
                           ||....||..:.:.:|:   :|:..|: |:..:..:|:.::: :||.|..
Human   268 ---------------GTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKIL-NHPRVYA 316

  Fly   376 QLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQDTVSLI 440
            .||:|.||.:..||..|:|.|....:..:|..:::.:|.:.:::|.||||.|||:::||:||.|:
Human   317 FLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIATDIICGFPGETDQDFQETVKLV 381

  Fly   441 QQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFREGATQLHRKMEGQEQLILI 505
            ::.::...::..:..|..|.|.:  .:.||..||.:|.:.:.:||...:...|:  .|:.|.:|:
Human   382 EEYKFPSLFINQFYPRPGTPAAK--MEQVPAQVKKQRTKDLSRVFHSYSPYDHK--IGERQQVLV 442

  Fly   506 EGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTARKSFGVGDFLAVRIEE 557
            ..:|          .|:...|.....|..|.|::..     .|.:|.:.:|:
Human   443 TEES----------FDSKFYVAHNQFYEQIRGENVC-----YGSWLELELEK 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 118/488 (24%)
UPF0004 93..196 CDD:279287 26/113 (23%)
TRAM 494..568 CDD:280171 12/65 (18%)
CDKAL1XP_024302249.1 UPF0004 65..445 CDD:332448 109/432 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126807
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.