DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and CDK5RAP1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001352657.1 Gene:CDK5RAP1 HGNCID:15880 Length:601 Species:Homo sapiens

Alignment Length:554 Identity:300/555 (54%)
Similarity:391/555 (70%) Gaps:17/555 (3%)


  Fly    36 KSEPAARATFLERIQRGPGFQDFFAVKPASRLKTDEEEHVDTSVPYLNSIDFNGNGRKVHFEVYG 100
            :.|..||..|..|:..||.||.|  :|.||..:......|:...|||...:..|..|||:.|.||
Human    46 RQEDGARKDFSSRLAAGPTFQHF--LKSASAPQEKLSSEVEDPPPYLMMDELLGRQRKVYLETYG 108

  Fly   101 CQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTRR 165
            ||||.||||:.:|||:::||||....:|||||:||||::|:.|||.|.|||..|:|:|.:|...|
Human   109 CQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCSIREKAEQTIWNRLHQLKALKTRRPRSR 173

  Fly   166 HPLQLTLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVLLSLDETYAD 230
            .||::.:||||||||||::|.:|:.||::||||:|:|||||||::.. |..|.||||||||||||
Human   174 VPLRIGILGCMAERLKEEILNREKMVDILAGPDAYRDLPRLLAVAES-GQQAANVLLSLDETYAD 237

  Fly   231 VMPVRLNSESPTAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAE----------- 284
            ||||:.::.:.:|||||||||||||:|||||||||||||||:|||:.|||.|:|           
Human   238 VMPVQTSASATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPIASILEEVKKLSEQVFLPPRPPKV 302

  Fly   285 ---QGVKEVTLLGQNVNSYRDRTAQEEQDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPD 346
               ||:||||||||||||:||.:..:...::......||:|.||.|.||..||.||..|::..|:
Human   303 LGLQGLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRVDPE 367

  Fly   347 MRIRFTSPHPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQF 411
            |||||||||||||.||||::|.:..|:|||:|||||||:::|||.||||||||||:|||.|||:.
Human   368 MRIRFTSPHPKDFPDEVLQLIHERDNICKQIHLPAQSGSSRVLEAMRRGYSREAYVELVHHIRES 432

  Fly   412 LPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNE 476
            :|.|.||||||.||||||||:...||||:::||||:.:|||||||:||.|:.|.|||||..||..
Human   433 IPGVSLSSDFIAGFCGETEEDHVQTVSLLREVQYNMGFLFAYSMRQKTRAYHRLKDDVPEEVKLR 497

  Fly   477 RLQRMVQVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTA 541
            ||:.::.:|||.||:.::...|..||:|:||.||||.....||||.|:|||.|...:....:...
Human   498 RLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGL 562

  Fly   542 RKSFGVGDFLAVRIEESNSQVLKGTPLELSNITD 575
            |.....||::.|:|..::||.|:|..|..:.:.|
Human   563 RVRAQPGDYVLVKITSASSQTLRGHVLCRTTLRD 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 282/496 (57%)
UPF0004 93..196 CDD:279287 59/103 (57%)
TRAM 494..568 CDD:280171 28/74 (38%)
CDK5RAP1NP_001352657.1 CDK5 activation inhibition 22..157 53/113 (47%)
UPF0004 88..588 CDD:332448 284/501 (57%)
CDK5R1-binding 475..586 48/111 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 1 1.000
Homologene 1 1.000 H9502
Inparanoid 1 1.050 579 1.000 Inparanoid score I1013
Isobase 1 0.950 0 Normalized mean entropy S2963
OMA 1 1.010
OrthoDB 1 1.010 D407532at33208
OrthoFinder 1 1.000 FOG0006046
OrthoInspector 1 1.000 T1074100
orthoMCL 1 0.900 OOG5_126807
Panther 1 1.100 LDO PTHR43020
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2454
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.