DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and cdkal1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_012819891.1 Gene:cdkal1 XenbaseID:XB-GENE-5895778 Length:579 Species:Xenopus tropicalis

Alignment Length:592 Identity:147/593 (25%)
Similarity:264/593 (45%) Gaps:116/593 (20%)


  Fly    19 ASKGATTSVTS---SAAGQLKSEPAARATFLERIQ------------RGPGFQDFFAVKPASRLK 68
            |.|...|::..   |..||  ..|||..:.|:.|:            |....|:   :.|.:|.:
 Frog     7 AGKKIRTAILCAHFSGVGQ--EMPAACESLLDDIEDIVSATDPKPHDRQNARQN---IVPRARKR 66

  Fly    69 T-----DEEEHVDTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEE 128
            .     :||...|:::|         ..:|:....:||..|.:|.|.:...|...||...::||:
 Frog    67 NKNKIQEEEPPADSTIP---------GTQKIWIRTWGCSHNNSDGEYMAGQLAAYGYSITEQPEQ 122

  Fly   129 ADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTRRHPLQLTLLGCM--AERLKEKL------- 184
            ||:.:|.:|.|:..||...||.:|..:....|         :.|.||:  |:..:|.:       
 Frog   123 ADLWLLNSCTVKSPAEDHFRNSIKKAQEANKK---------VVLSGCVPQAQPRQEYMKGLSIIG 178

  Fly   185 LEQ-EQCVDVIAGPDSYK-DLPRLLAISRHYGNSAINVLLSLDETYADVMPVRLNSESP-TAFVS 246
            ::| ::.|:|:  .::.| ...|||...:..|.       .|.....|:..:|.|   | ...:|
 Frog   179 VQQIDRVVEVV--EETIKGHSVRLLGQKKDNGK-------RLGGARLDLPKIRKN---PLIEIIS 231

  Fly   247 IMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQNVNSY-RDRTAQEEQD 310
            |..||.|.||||.....||...|.|:..:|.......::||.|:.|..::..:| ||.       
 Frog   232 INTGCLNACTYCKTKHARGELASYPVEELVDRAAQSFQEGVCEIWLTSEDTGAYGRDI------- 289

  Fly   311 SLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPD---MRIRFTS-PHPKDFSDEVLEVIRDHP 371
                               ||....||..:.:.:|:   :|:..|: |:..:..:|:.::: :||
 Frog   290 -------------------GTDLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKIL-NHP 334

  Fly   372 NVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQDT 436
            .|...||:|.||.:..||..|:|.|....:..:|..:::.:|.:.:::|.||||.|||:|:|::|
 Frog   335 RVYAFLHIPVQSASDSVLMDMKREYCIADFKRVVDFLKERVPGITIATDIICGFPGETDEDFKET 399

  Fly   437 VSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFREGATQLHRKMEGQEQ 501
            :.|:::.::...::..:..|..|.|.:  .:.||.:||.:|.:.:.|:|...:...|:  .|:||
 Frog   400 LKLVEEYKFPSLFINQFYPRPGTPAAK--MEQVPAHVKKQRTKELSQLFHSYSPYDHK--IGEEQ 460

  Fly   502 LILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTARKSFGVGDFLAVRIEESNSQVLKGT 566
            .:|:..:|..|. ::...|....:|:||            :....||..:.|:|.|:....:||.
 Frog   461 HVLVTEESFDSQ-YYVSHNRFYEQVLVP------------KDPAFVGKMVEVKIFEAGKHFMKGQ 512

  Fly   567 PLELSNI 573
            |::.|.|
 Frog   513 PVQDSYI 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 126/499 (25%)
UPF0004 93..196 CDD:279287 30/113 (27%)
TRAM 494..568 CDD:280171 18/74 (24%)
cdkal1XP_012819891.1 MiaB-like-B 87..514 CDD:273703 126/492 (26%)
UPF0004 87..168 CDD:279287 26/90 (29%)
Radical_SAM 230..433 CDD:100105 62/232 (27%)
TRAM 455..514 CDD:294784 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.