DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and cdkal1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_956921.1 Gene:cdkal1 ZFINID:ZDB-GENE-040426-1443 Length:547 Species:Danio rerio

Alignment Length:559 Identity:137/560 (24%)
Similarity:239/560 (43%) Gaps:111/560 (20%)


  Fly    38 EPAARATFLERIQRGPGFQDFFAVKPASR---LKTDEEEHVDTSVPYLNSIDFNGNGRKVHFEVY 99
            |...|.|.:..:||....:   :|.|.:|   .:|.|:...|:.:|.:         :||..:.:
Zfish    14 EDMVRITDVTPLQRQAARK---SVVPRARKHKQETGEQMQTDSVIPGM---------QKVWLKTW 66

  Fly   100 GCQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTR 164
            ||..|::|.|.:...|...||...::..:||:.:|.:|.|:..||...||.::..:....|    
Zfish    67 GCSHNSSDGEYMAGQLAVAGYQITEDSSDADLWLLNSCTVKSPAEDHFRNAIRKAQEQNKK---- 127

  Fly   165 RHPLQLTLLGCMAER------LKEKLLEQEQCVD--------VIAGPDSYKDLPRLLAISRHYGN 215
                 :.|.||:.:.      :|:..:...|.:|        .|.|..     .|||...:..|.
Zfish   128 -----VVLAGCVPQAQPRMDYIKDLSIIGVQQIDRVVEVVDEAIKGHS-----VRLLGQKKEKGK 182

  Fly   216 SAINVLLSLDETYADVMPVRLNSESP-TAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEV 279
                   .|.....|:..:|.|   | ...:||..||.|.||||.....||...|.|:..:|..|
Zfish   183 -------RLGGARLDLPKIRKN---PLIEIISINTGCLNACTYCKTKHARGDLASYPVEELVERV 237

  Fly   280 KALAEQGVKEVTLLGQNVNSY-RDRTAQEEQDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQA 343
            :...::||.|:.|..::..:| ||.                          |:....||..:.:.
Zfish   238 RQSFQEGVCEIWLTSEDTGAYGRDI--------------------------GSDLPTLLWRLVEE 276

  Fly   344 VPD---MRIRFTSP-----HPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREA 400
            :|:   :|:..|:|     |.::.|.     |..||.|...||:|.||.:..||..|||.|....
Zfish   277 IPEGAMLRLGMTNPPYILEHLEEMSR-----ILQHPRVFSFLHVPLQSASDSVLMEMRREYCCAD 336

  Fly   401 YLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRY 465
            :..||.::::.:|.:.:::|.||||.|||:|:|:.|::|:::.::...::..:..|..|.|  ..
Zfish   337 FTHLVDYLKERVPGITIATDIICGFPGETDEDFEQTLALVRRYRFPSLFINQFYPRPGTPA--AL 399

  Fly   466 KDDVPINVKNERLQRMVQVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPS 530
            ...:|.:||.:|.:.:..:|.......|:.  |::|.:|:..:|..|. ::...|....:|:||.
Zfish   400 MQQLPAHVKKQRTKELSALFHSYRPYDHKM--GEQQQVLVTEESFDSQ-YYVAHNKFYEQVLVPK 461

  Fly   531 IYVPISGDSTARKSFGVGDFLAVRIEESNSQVLKGTPLE 569
                       |..: :|..:.|.:.|.....:||.|||
Zfish   462 -----------RPEY-LGKMVQVEVYECGKHYMKGRPLE 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 125/507 (25%)
UPF0004 93..196 CDD:279287 27/117 (23%)
TRAM 494..568 CDD:280171 16/74 (22%)
cdkal1NP_956921.1 MiaB-like-B 60..487 CDD:273703 123/499 (25%)
UPF0004 60..139 CDD:279287 23/88 (26%)
Radical_SAM 203..400 CDD:100105 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.