DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and Cdkal1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_006222444.1 Gene:Cdkal1 RGDID:1310246 Length:578 Species:Rattus norvegicus

Alignment Length:540 Identity:135/541 (25%)
Similarity:237/541 (44%) Gaps:111/541 (21%)


  Fly    76 DTSVPYLNSIDFNGNGRKVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVR 140
            |:::|.:         :|:....:||..|.:|.|.:...|...||...:...:||:.:|.:|.|:
  Rat    56 DSTIPGI---------QKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVK 111

  Fly   141 DGAEQRIRNRLKHLRAMKNKRSTRRHPLQLTLLGCMAERLKEK----------LLEQEQCVDVIA 195
            :.||...||.:|.... :||:        :.|.||:.:....:          :.:.::.|:|: 
  Rat   112 NPAEDHFRNSIKKAHE-ENKK--------VVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVV- 166

  Fly   196 GPDSYK-DLPRLLAISRHYGNSAINVLLSLDETYADVMPVRLNSESP-TAFVSIMRGCDNMCTYC 258
             .::.| ...|||...:..|.       .|.....|:..:|.|   | ...:||..||.|.||||
  Rat   167 -EETIKGHSVRLLGQKKESGK-------RLGGARLDLPKIRKN---PLIEIISINTGCLNACTYC 220

  Fly   259 IVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQNVNSY-RDRTAQEEQDSLKATPVPGFST 322
            .....||...|.|:..:|...|...::||.|:.|..::..:| ||.                   
  Rat   221 KTKHARGNLASYPIDELVERAKQSFQEGVCEIWLTSEDTGAYGRDI------------------- 266

  Fly   323 VYKPKTGGTPFAALLRSVAQAVPD---MRIRFTS-PHPKDFSDEVLEVIRDHPNVCKQLHLPAQS 383
                   ||....||..:.:.:|:   :|:..|: |:..:..:|:.::: :||.|...||:|.||
  Rat   267 -------GTDLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKIL-NHPRVYAFLHIPVQS 323

  Fly   384 GNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVA 448
            .:..||..|:|.|....:..:|..:::.:|.:.:::|.||||.|||:::||:||.|:::.::...
  Rat   324 ASDSVLMDMKREYCVADFKRVVDFLKEKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSL 388

  Fly   449 YLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFREGATQLHRKMEGQEQLILIEG-KSKRS 512
            ::..:..|..|.|.:  ...||.:||.:|.:.:.:||.......|:..|.|:.|:..|. .||..
  Rat   389 FINQFYPRPGTPAAK--AKQVPAHVKKQRTKDLSRVFHSYNPYDHKIGERQQVLVTEESFDSKFY 451

  Fly   513 DAHWFGRNDANIKVIVPSIYVPISGDSTARKSFGVGDFLAVRIEESNSQVLKGTPL--------- 568
            .||    |....:|:||.           ..:| :|..:.|.|.||....|||.|:         
  Rat   452 VAH----NRFYEQVLVPK-----------NPAF-MGKMVEVDIYESGKHFLKGQPVSETRVYTPS 500

  Fly   569 --------ELSNI-TDFHSR 579
                    |:|.: |:|.:|
  Rat   501 ICKPLAKGEVSGLTTEFRNR 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 129/517 (25%)
UPF0004 93..196 CDD:279287 26/113 (23%)
TRAM 494..568 CDD:280171 22/75 (29%)
Cdkal1XP_006222444.1 MiaB-like-B 64..491 CDD:273703 128/493 (26%)
UPF0004 64..145 CDD:279287 24/90 (27%)
Radical_SAM 207..404 CDD:100105 62/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.