DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and Cdk5rap1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_006235368.1 Gene:Cdk5rap1 RGDID:708387 Length:648 Species:Rattus norvegicus

Alignment Length:538 Identity:299/539 (55%)
Similarity:386/539 (72%) Gaps:2/539 (0%)


  Fly    28 TSSAAGQLKSEPAARATFLERIQRGPGFQDFFAVKPASRLKTDEEEHVDTSVPYLNSIDFNGNGR 92
            ||....:.||....:..|..|:..||.||.|.......:.|....| |:...|||:..:..|..|
  Rat    96 TSCPDPEGKSSEGVQKDFSSRLATGPTFQHFLRSASVPQEKPSSPE-VEDPPPYLSGDELLGRQR 159

  Fly    93 KVHFEVYGCQMNTNDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKHLRAM 157
            ||:.|.||||||.||||:.:|||:::||||....:|||||:||||::|:.|||.|.|||..|:.:
  Rat   160 KVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCSIREKAEQTIWNRLHQLKVL 224

  Fly   158 KNKRSTRRHPLQLTLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVLL 222
            |.||...|.||::.:|||||||||.::|.:|:.||::||||:|:|||||||:... |..|.||||
  Rat   225 KAKRPRSRVPLRIGILGCMAERLKGEILNREKMVDLLAGPDAYRDLPRLLAVVES-GQQAANVLL 288

  Fly   223 SLDETYADVMPVRLNSESPTAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGV 287
            ||||||||:|||:.:..:.:|||||||||||||:|||||||||||||||:|||:.||:.|:|||:
  Rat   289 SLDETYADIMPVQTSPSATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPVASILDEVRKLSEQGL 353

  Fly   288 KEVTLLGQNVNSYRDRTAQEEQDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPDMRIRFT 352
            ||||||||||||:||.:..:...:..|....||:|.||||.||..|:.||..|::..|:||||||
  Rat   354 KEVTLLGQNVNSFRDNSEVQFSSTGSANLSRGFTTNYKPKQGGLRFSHLLDQVSRIDPEMRIRFT 418

  Fly   353 SPHPKDFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGL 417
            |||||||.||||::||:..|:|||:|||||||:::|||.||||||||||:.||.|||:.:|.|||
  Rat   419 SPHPKDFPDEVLQLIRERHNICKQIHLPAQSGSSRVLEAMRRGYSREAYVALVHHIREAIPGVGL 483

  Fly   418 SSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMV 482
            |||||.|||||||::...||||:::||||..:|||||||:||.|:.|.|||||..||..||:.::
  Rat   484 SSDFITGFCGETEDDHLQTVSLLREVQYNTGFLFAYSMRQKTRAYHRLKDDVPEEVKLRRLEELI 548

  Fly   483 QVFREGATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTARKSFGV 547
            .||||.|::::....|..||:|:||.||||.....||||||:|||.|...|....|...:.....
  Rat   549 TVFREEASKVNATSVGCTQLVLVEGFSKRSTTDLCGRNDANLKVIFPDAEVEDITDPGLKVRAQP 613

  Fly   548 GDFLAVRIEESNSQVLKG 565
            ||::.|:|..::||.|||
  Rat   614 GDYVLVKIISASSQTLKG 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 282/479 (59%)
UPF0004 93..196 CDD:279287 58/103 (56%)
TRAM 494..568 CDD:280171 31/73 (42%)
Cdk5rap1XP_006235368.1 PRK14329 147..633 CDD:237676 285/487 (59%)
UPF0004 160..263 CDD:279287 58/103 (56%)
TRAM 563..634 CDD:280171 31/70 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 1 1.000
Homologene 1 1.000 H9502
Inparanoid 1 1.050 579 1.000 Inparanoid score I973
OMA 1 1.010
OrthoDB 1 1.010 D407532at33208
OrthoFinder 1 1.000 FOG0006046
OrthoInspector 1 1.000 T1087747
orthoMCL 1 0.900 OOG5_126807
Panther 1 1.100 LDO PTHR43020
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.840

Return to query results.
Submit another query.