DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and Y92H12BL.4

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_490846.4 Gene:Y92H12BL.4 WormBaseID:WBGene00022365 Length:397 Species:Caenorhabditis elegans

Alignment Length:238 Identity:53/239 (22%)
Similarity:94/239 (39%) Gaps:71/239 (30%)


  Fly    49 IQRGP-GFQDFFAVKPASRLKTDEEE-----HVDTSVPYLNSIDFNGNGRKVHFEVYGCQMNTND 107
            :.||| |.:|...:|..:|.:..:|:     :||:.||        |.|:||....:||..||:|
 Worm     7 VGRGPVGSRDANEIKIRTRKQVPKEQQPDDANVDSMVP--------GVGQKVWVRTWGCSHNTSD 63

  Fly   108 TEVVFSILKENGYLRCQEPEEADVIMLVTCA----------VRDGA------------EQRIRNR 150
            :|.:..:|::.||         ||:...:..          :||.|            .::.|.:
 Worm    64 SEYMSGLLQQAGY---------DVVKGFSIIFGIYLNFKNFLRDNASAIFNFFLFFSFSEKKRKK 119

  Fly   151 LKHLRAMK-------NKRSTRRHPLQLTLLGCM--AERLKEKLLE-QEQCVDVIAGPDSYKDLPR 205
            .|    ||       |::..|...|...:|..:  .|.:.|||.| ..:.:|.|.      |||.
 Worm   120 FK----MKMIFFLSFNEKKRRGWELLAIVLAFIFPTEAINEKLNEFLNKHLDPIF------DLPE 174

  Fly   206 LLAISRHYGNSAI----NVLLSLDETYADVMPVRLNSESPTAF 244
            :  .:.::....|    .|:..|..:.:.:...:::...|..|
 Worm   175 V--STSYFSQQCIKRLSKVIARLKPSLSTIQETKIHIFRPPLF 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 41/194 (21%)
UPF0004 93..196 CDD:279287 31/135 (23%)
TRAM 494..568 CDD:280171
Y92H12BL.4NP_490846.4 UPF0004 49..>79 CDD:279287 13/39 (33%)
MyTH4 <135..203 CDD:295320 16/76 (21%)
RhoGAP 215..384 CDD:295372 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.