DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and Y92H12BL.1

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_740783.2 Gene:Y92H12BL.1 WormBaseID:WBGene00022363 Length:425 Species:Caenorhabditis elegans

Alignment Length:388 Identity:98/389 (25%)
Similarity:171/389 (44%) Gaps:100/389 (26%)


  Fly   181 KEKLLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVLLSLDETYADVMPVRLNSESPTAFV 245
            |.:||.:.:       ||:...||::..      |..|.||                        
 Worm    41 KVRLLTRNR-------PDAVLSLPKMRK------NELIEVL------------------------ 68

  Fly   246 SIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVK-ALAEQGVKEVTLLGQNVNSY-RDRTAQEE 308
            ||..||.|.||||.....||...|.|||.:|.:.: |..::||||:.|..:::.:: ||.     
 Worm    69 SISTGCLNNCTYCKTKMARGDLVSYPLADLVEQARAAFHDEGVKELWLTSEDLGAWGRDI----- 128

  Fly   309 QDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPD---MRIRFTS-PHPKDFSDEVLEVIRD 369
                                 |.....|||.:.:.:||   ||:..|: |:..|..:|:.|:: :
 Worm   129 ---------------------GLVLPDLLRELVKVIPDGSMMRLGMTNPPYILDHLEEIAEIL-N 171

  Fly   370 HPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFICGFCGETEEEFQ 434
            ||.|...||:|.||.:..||..|:|.|||..:.::..::...:||:.:::|.|..|..||.|:|:
 Worm   172 HPKVYAFLHIPVQSASDAVLNDMKREYSRRHFEQIADYMIANVPNIYIATDMILAFPTETLEDFE 236

  Fly   435 DTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFR-------EGATQL 492
            :::.|:::.::...::..|..|..|.|.|..|.|. :..: :|...|.::||       |...:|
 Worm   237 ESMELVRKYKFPSLFINQYYPRSGTPAARLKKIDT-VEAR-KRTAAMSELFRSYTRYTDERIGEL 299

  Fly   493 HRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTARKSFGVGDFLAVRI 555
            ||       :::.|..:.:  .|..|.|.:..:::||..|..            :|:::.||:
 Worm   300 HR-------VLVTEVAADK--LHGVGHNKSYEQILVPLEYCK------------MGEWIEVRV 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 98/389 (25%)
UPF0004 93..196 CDD:279287 3/15 (20%)
TRAM 494..568 CDD:280171 11/63 (17%)
Y92H12BL.1NP_740783.2 Elp3 67..268 CDD:214792 69/252 (27%)
Radical_SAM 68..273 CDD:100105 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D407532at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126807
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.