DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6345 and F25B5.5

Sequence 1:NP_650002.1 Gene:CG6345 FlyBaseID:FBgn0037816 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_498290.1 Gene:F25B5.5 WormBaseID:WBGene00017776 Length:547 Species:Caenorhabditis elegans

Alignment Length:541 Identity:265/542 (49%)
Similarity:359/542 (66%) Gaps:48/542 (9%)


  Fly    60 AVKPASRLKTD------------EEEHVDTSVP-------YLNSIDFNGNGRKVHFEVYGCQMNT 105
            ||||...:.||            :::.....:|       |||..|..||||.|.:..||||||.
 Worm    28 AVKPKRAIPTDGLQLSDFIKESTKKQRQKAIIPSIEDTKEYLNPEDLQGNGRTVCYVTYGCQMNV 92

  Fly   106 NDTEVVFSILKENGYLRCQEPEEADVIMLVTCAVRDGAEQRIRNRLKHLRAMKNKRSTRRHPLQL 170
            :|.|:|.||:.:.|::...:.|.||:::|:||::|||||:::.|:||.:|:    .|..:..: :
 Worm    93 SDMEIVRSIMTKYGFVESDKKENADIVLLMTCSIRDGAEKKVWNQLKLIRS----NSVNKGQI-V 152

  Fly   171 TLLGCMAERLKEKLLEQEQCVDVIAGPDSYKDLPRLLAISRHYGNSAINVLLSLDETYADVMPVR 235
            .:|||||||::..|||:...|:::||||||:|||||:|::.. |::.|||.||||||||||.|:|
 Worm   153 GVLGCMAERVRHDLLEKRNLVNIVAGPDSYRDLPRLVAVAAG-GSNGINVQLSLDETYADVQPIR 216

  Fly   236 LNSESPTAFVSIMRGCDNMCTYCIVPFTRGRERSRPLASIVAEVKALAEQGVKEVTLLGQNVNSY 300
            ::|.|.|||:|||||||||||||:||||||||||||:.|||.||:.|.:||.|:|||||||||||
 Worm   217 VDSASKTAFISIMRGCDNMCTYCVVPFTRGRERSRPIESIVEEVQRLRDQGYKQVTLLGQNVNSY 281

  Fly   301 RDRTAQE--------EQDSLKATPVPGFSTVYKPKTGGTPFAALLRSVAQAVPDMRIRFTSPHPK 357
            ||.|:.:        ::|.     ||||.||||||:||..|..||..||.|.||:|.||||||||
 Worm   282 RDMTSMDFSMAPSTSQEDR-----VPGFKTVYKPKSGGLTFTTLLEKVADAAPDIRFRFTSPHPK 341

  Fly   358 DFSDEVLEVIRDHPNVCKQLHLPAQSGNTQVLERMRRGYSREAYLELVQHIRQFLPNVGLSSDFI 422
            ||..:::|:|...||:|||||||||||:.:.||||.|||:|:.||.||..||..||:|.|:||||
 Worm   342 DFPMQLIELIASRPNLCKQLHLPAQSGDDETLERMERGYTRDLYLRLVDDIRHVLPSVSLTSDFI 406

  Fly   423 CGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRRYKDDVPINVKNERLQRMVQVFRE 487
            .|||||||:..|:|:|||:.|:|:..::|.||||.||.||.|..||||.:||..|...:..||||
 Worm   407 AGFCGETEQAHQNTLSLIRAVRYSFCFVFPYSMRGKTRAHHRLTDDVPEDVKARRHLDLTTVFRE 471

  Fly   488 GATQLHRKMEGQEQLILIEGKSKRSDAHWFGRNDANIKVIVPSIYVPISGDSTARKSFGVGDFLA 552
            .|.:|::.:.|.||.:|:||||||..:...||.|..:|.:.          ..::.....|.:..
 Worm   472 EALKLNQALIGSEQTVLLEGKSKRDASFSHGRIDGGVKAVF----------DNSKLCLEPGQYAK 526

  Fly   553 VRIEESNSQVLKGTPLELSNI 573
            :.|.::|||.||...:..|:|
 Worm   527 ILITDANSQTLKAQLIGQSSI 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6345NP_650002.1 PRK14329 88..570 CDD:237676 252/490 (51%)
UPF0004 93..196 CDD:279287 41/103 (40%)
TRAM 494..568 CDD:280171 21/74 (28%)
F25B5.5NP_498290.1 PRK14329 62..544 CDD:237676 256/503 (51%)
UPF0004 80..178 CDD:279287 41/103 (40%)
TRAM 478..542 CDD:280171 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205515273
eggNOG 1 0.900 E1_COG0621
Hieranoid 1 1.000
Homologene 1 1.000 H9502
Inparanoid 1 1.050 505 1.000 Inparanoid score I727
Isobase 1 0.950 0 Normalized mean entropy S2963
OMA 1 1.010
OrthoDB 1 1.010 D407532at33208
OrthoFinder 1 1.000 FOG0006046
OrthoInspector 1 1.000 T476380
orthoMCL 1 0.900 OOG5_126807
Panther 1 1.100 LDO PTHR43020
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2454
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.