DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42795 and grtp1b

DIOPT Version :10

Sequence 1:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster
Sequence 2:NP_001017810.1 Gene:grtp1b / 550508 ZFINID:ZDB-GENE-050417-346 Length:349 Species:Danio rerio


Alignment Length:267 Identity:72/267 - (26%)
Similarity:123/267 - (46%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 DEATSDY--------NQWLHA----------MKLVARLPGGTPPEFRRKLWLSL--ADKYLKSKN 243
            :|..|||        .:|...          :|:...:..|.|.|.|.::|::.  |...|: :|
Zfish    39 EELMSDYLAVVTRRSKKWSKLLQGTGKMEKNLKVKRYVRKGIPCEHRTEIWMAFSGAQDQLE-RN 102

  Fly   244 VDWAQQREKCFCEEWREDDEELGIQIVKDLHRT---------GSNLCTGPAGSINQAKLKRILLG 299
            ..:.|...|.     .:.|.::...|..|:|||         .|..|.       |..|..:||.
Zfish   103 PGYYQALLKT-----EQHDPKIEEVIHADMHRTFPDNIQFRHSSQSCL-------QKALFNVLLA 155

  Fly   300 YARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRE 364
            |..:|.:||||||.|.:...:| ::.|:||:|..:|:.|:..:|| .|:..:|.||:.|..|..|
Zfish   156 YGHHNKDVGYCQGMNFIAGYLL-IITKDEEKSFWLMVALIGRILP-DYYTQTMLGLKVDQEVLGE 218

  Fly   365 LMQTRLPRLAKHLQRLQGPVENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVL 429
            |:::::|.:.:.:.:         ...:..:...:||:.::...||:..|||:||.:..|||.:|
Zfish   219 LVKSKVPAVWQTMNQ---------HDVMWTLVVSRWFICLYVDVLPVETVLRIWDCLFYEGSKIL 274

  Fly   430 LRTALVL 436
            .|.||.|
Zfish   275 FRVALTL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:459855 55/178 (31%)
DUF4682 560..689 CDD:464830
PTZ00121 <1112..2009 CDD:173412
PTZ00121 <1740..2340 CDD:173412
PTZ00449 <2270..2610 CDD:185628
grtp1bNP_001017810.1 TBC 76..289 CDD:214540 66/230 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.