DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42795 and CG5916

DIOPT Version :10

Sequence 1:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster
Sequence 2:NP_650524.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:140/288 - (48%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 KLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQRE-KCFCEEWRED--DEELGIQIVKDLH 274
            ||...:..|.|..:|..:|       :|......||:|. ..|....|.:  |:|:...|..||.
  Fly    62 KLKRYIRKGIPGPYRPDVW-------MKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLP 119

  Fly   275 RT-GSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYL 338
            || ..|:    ...:.:.:|..||:.||.:|.:||||||.|.:..|:|.|.| :||:|..::.::
  Fly   120 RTFPDNI----HFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTD-DEEKSFWLLKHI 179

  Fly   339 VEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPVENAFEPPLTNVFTMQWFLT 403
            ||.::|. |...:|..|..|:.|||||:..|:|.:.:|:..|..|..         |...:||:.
  Fly   180 VENIVPQ-YHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYP---------VIASKWFIC 234

  Fly   404 MFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGH 468
            :|...||:..|||:||.|..||..::.|.||.::...:..::   ..|:.......:...::..:
  Fly   235 IFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAIL---GCDDIAALANLFRDTMIQDN 296

  Fly   469 LV-DSNGLIERV----VKLGPIEDLRQL 491
            :| |.:|.:|.:    :|...:|.||::
  Fly   297 IVTDCHGFVEAMFSLRLKRSELESLRKV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:459855 60/175 (34%)
DUF4682 560..689 CDD:464830
PTZ00121 <1112..2009 CDD:173412
PTZ00121 <1740..2340 CDD:173412
PTZ00449 <2270..2610 CDD:185628
CG5916NP_650524.1 TBC 67..276 CDD:214540 72/230 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.