DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and alpi.1

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001014375.1 Gene:alpi.1 ZFINID:ZDB-GENE-050327-78 Length:532 Species:Danio rerio

Alignment Length:524 Identity:121/525 (23%)
Similarity:210/525 (40%) Gaps:110/525 (21%)


  Fly    23 LVAGTCLITVMVTLLCIGFMTRYEVENDVANVADVDYWKDKVATSQKIWYDKGIDELNEALR-PQ 86
            ||.|.....:::.||.:...|...:::......|..||.|:...:           |..||. |.
Zfish     3 LVYGRAPGALLLLLLALVLNTSCSLDSAAEWEKDPAYWNDQARRT-----------LQTALTLPL 56

  Fly    87 DLTYPKNVRIFVIQGIDGRDWAAFRF---PTSDASRGNTNFIWDRFPHLARLKNSCSQQFPCQVA 148
            .:...||:.:||..|:.....:|.|.   .....|...|....|.||:||..|..|..:.....|
Zfish    57 RVNRAKNIILFVGDGMGVSTVSAARILRGQMEGQSGEETILAMDTFPYLALSKTYCVDKQVADSA 121

  Fly   149 SVSRALWLGIPLD------KVPDNQQDCGRLFNATQG--PISILRQAQLAGLRTGFVTTQRI--T 203
            |.:.|...|:..:      .......:|    |.|.|  ..|:|.:|:..|...|.|||.|:  .
Zfish   122 STATAYHCGVKANAKTVGLSAKAVAYEC----NTTFGNEVFSVLHRAKAQGKSVGIVTTTRVQHA 182

  Fly   204 GPTGAALGNANGNFECDESMPLNSIKSGCQDIAQQLISDETGKFLNVLIGGGRQMLSSLVPNTKY 268
            .|..|...:.:..:..|..:|..:.:.||:|||.||:   |...::|::||||..::   |....
Zfish   183 SPAAAYAHSVSRKWYSDADVPSEARRQGCKDIATQLV---TNTDIDVILGGGRMYMT---PKGTP 241

  Fly   269 DPVDEMLCESNDG-----RNLLKDWRNQKLKESKINRIIFDLIQRRDELESLNSSSFDYLMGVMA 328
            ||  |....|:.|     :||:..|.|.:...:.      ..:..:::..:::..:.|.|||:..
Zfish   242 DP--EYSSSSHKGDRKDKKNLINVWLNARKGRNA------QYVWNKEQFNAVDVKTTDCLMGLFE 298

  Fly   329 NGDL-----SGNSKAPSLKLMVDKSLNVLTKYKQGYLLIVE-QFIPSGIDKREQLQLLNDTLV-- 385
            ..|:     ...::.||:..|.:|::.:|:|..:|:.|.|| ..|..|.........|.:|::  
Zfish   299 PKDMRFEVFRNRTRDPSIVDMTEKAIQILSKNPKGFFLFVEGGRIDHGHHDGVAKLALTETIMFD 363

  Fly   386 -------NLHKDQDTLTLVLMT--------------NAIY---PKPSLD---------------- 410
                   .|..:.||||:|...              |.|:   ||.:.|                
Zfish   364 RAIQRASELTSESDTLTVVTADHSHVFTFGGKTPRGNPIFGLAPKQAEDDLPYTSILYANGPGYD 428

  Fly   411 -VSEETETISLLPEIFNEAESEIQKRLHQMPSES--------LLFAQGPKSSIFQGVRKETFLAH 466
             |:.....:|:|     :...|..|:...:|.||        .::|:||.:.:|.||:::.::||
Zfish   429 HVNGTRGNVSVL-----DYYDEEYKQQAAVPLESETHGGEDVAIYAKGPMAHLFHGVKEQNYVAH 488

  Fly   467 AISH 470
            |:::
Zfish   489 AMAY 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 98/417 (24%)
alpi.1NP_001014375.1 PhoA 46..493 CDD:224699 111/482 (23%)
Alk_phosphatase 61..496 CDD:278666 107/456 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21896007
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.