DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and Alp10

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster

Alignment Length:485 Identity:129/486 (27%)
Similarity:205/486 (42%) Gaps:110/486 (23%)


  Fly    27 TCLITVMVTLLCIGFMTRYEVENDVANV-----------------ADVDYWKDKVATSQKIWYDK 74
            :|||.....||.|  ..|.::.:|..:.                 .|..:|.||   :|.|..||
  Fly     4 SCLILCFFALLVI--QARSDLADDQEHAQHPRLQSSRDFEALDEELDTRFWHDK---AQSILADK 63

  Fly    75 --GIDELNEALRPQDLTYPKNVRIFVIQGIDGRDWAAFRFPTSDASRGNTNFIWDRFPHLARLKN 137
              |..:|||       ...|||.:|:..|:.....||.|....|:   |....:::||:|...|.
  Fly    64 LAGHKKLNE-------NRAKNVILFLGDGMSVHTIAATRAFMGDS---NKQVFFEKFPYLGLSKT 118

  Fly   138 SCSQQFPCQVASVSRALWLGIPLD--KVPDNQQ----DCGRLFNATQGPISILRQAQLAGLRTGF 196
            ....:.....|:.:.|...|:..:  .:..|.|    ||  :.|::....||.:.||.||...|.
  Fly   119 YAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDC--VTNSSSHVQSIGQWAQEAGKWAGL 181

  Fly   197 VTTQRIT--GPTGAALGNANGNFECDESMPLNSIKSGCQ-----DIAQQLISDETGKFLNVLIGG 254
            |||.|:|  .|.|.....:..|:|.|..:    |.|.|.     |||:||:....|:.|.|::||
  Fly   182 VTTARVTHASPAGVYAHVSERNWEHDGEI----ISSKCSPDVNTDIARQLVEWPVGQELRVIMGG 242

  Fly   255 GRQMLSSLVPNTKYDPVDEMLCESNDGRNLLKDWRNQKLKESKINRIIFDLIQRRDELESLNSSS 319
            ||   |.....:::|........: |||:|:.|||..|.::....:.::.|    ..|:..:.|.
  Fly   243 GR---SYFRDQSQHDETGVSGLRT-DGRDLISDWREIKKQQGAEGKYVWSL----KGLKETDISK 299

  Fly   320 FDYLMGVMANGDL--SGNSK-------APSLKLMVDKSLNVLTKYKQGYLLIVEQFIPSG-ID-- 372
            .|||:|:.....|  .|:.:       .|||..|.:.::.:|:|.::||.|.||    || ||  
  Fly   300 TDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFLFVE----SGRIDMA 360

  Fly   373 --KREQLQLLNDT-----LVNLHK----DQDTLTLVLM----TNAI--YPKPSLDVSEETETISL 420
              ..:.::.|.||     .|.|.:    ::|||.:|..    |.:|  ||....::      :||
  Fly   361 HHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQNI------LSL 419

  Fly   421 LPEIFNEAESEIQKRLHQMPSESLLFAQGP 450
            .|.:.::          ::|...|.:|.||
  Fly   420 APNLADD----------ELPFTILSYANGP 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 99/367 (27%)
Alp10NP_647976.1 PhoA 56..510 CDD:224699 117/429 (27%)
ALP_like 75..511 CDD:304875 109/403 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455748
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.