DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and Alp6

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_610496.1 Gene:Alp6 FlyBaseID:FBgn0033423 Length:515 Species:Drosophila melanogaster

Alignment Length:514 Identity:115/515 (22%)
Similarity:200/515 (39%) Gaps:111/515 (22%)


  Fly    30 ITVMVTLLCIGFMTRYEVENDVANVADVDYWKDKVATSQ--KIWYDKGIDELNEALRPQD---LT 89
            |.::|..:|:......:.::......|.:....|.|..|  :.|.||...:|...|..|:   ..
  Fly     6 ILLLVLAVCLSGSASGQRDHPRGRSFDAESHPIKYAEEQQTQYWVDKAQAKLLSKLAEQESATTN 70

  Fly    90 YPKNVRIFVIQGIDGRDWAAFRFPTSDASRGNTNFIWDRFPHLARLKNSCSQQFPCQVASVSRAL 154
            ..|||.:|:..|:......|.|....|::.   ...::.||:....|..|..:.....|..:.|.
  Fly    71 KAKNVILFLGDGMSVHTVTATRNLLGDSAE---QVYFEGFPYTGLSKTYCVNRQVADSACTATAY 132

  Fly   155 WLGIPLD------KVPDNQQDCGRLFNATQGPISILRQAQLAGLRTGFVTTQRIT--GPTG--AA 209
            ..|:..:      ....::..|....|.....:||...||.||...|.|||.|:|  .|.|  |.
  Fly   133 LGGVKANYGTIGVNANVSRYSCDGAANEEDRVLSIAHWAQAAGKDAGLVTTARVTHASPAGVYAH 197

  Fly   210 LGNAN-------GNFECDESMPLNSIKSGCQDIAQQLISDETGKFLNVLIGGGRQ-MLSSLVPNT 266
            :.:.|       .|.|||....:        |||:||:....|:.|.|::||||: .:.:.|.:.
  Fly   198 IADRNWENDWEVANRECDPEQTI--------DIARQLVEQPVGQQLKVILGGGRKNFIDATVNDE 254

  Fly   267 KYDPVDEMLCESNDGRNLLKDWRNQKLKESKINRIIFDLIQRRDELESLNSSSFDYLMGVMANGD 331
            :..|     .:..|||:|::.|.:|| ||:.::.   ..:..|..|..::..:.|||:|:.||..
  Fly   255 EGYP-----GKRTDGRHLIRSWLDQK-KEANVSA---KYVWSRKGLSLVDLENTDYLLGLFANDH 310

  Fly   332 LSGNSKA---------PSLKLMVDKSLNVLTKYKQGYLLIVE---------------------QF 366
            |..|...         |||..:.:.::.||::..:|:.|.||                     :|
  Fly   311 LPYNGDRDRKRSQLADPSLSELTEAAITVLSRNDKGFFLFVEGARIDMAHHDTFAKRSLEDTAEF 375

  Fly   367 IPSGIDKREQLQLLNDTLVNL--------------HKDQDTLTLVLMTNAIYPKPSLDVSEETET 417
             ...:.|..:|...:|||:.:              ::||:...|..:.:...|...|..:.....
  Fly   376 -ARAVQKARELTSEDDTLIVVTADHAHVMSINGYPYRDQEITGLAQLADDNLPYTILSYANGPGY 439

  Fly   418 ISLLPEIFNEAESE--IQKRL-----HQMPS------------ESLLFAQGPKSSIFQG 457
            .|    .:|.||..  ::::|     :|.|:            :..::|.||.:..|.|
  Fly   440 YS----GYNRAEGRALLKEKLVADSDYQYPTLAPLDAETHGGDDVAVYASGPYAQYFSG 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 94/413 (23%)
Alp6NP_610496.1 ALP_like 72..511 CDD:304875 102/449 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455798
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.