DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and Alp11

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_573047.1 Gene:Alp11 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster

Alignment Length:475 Identity:101/476 (21%)
Similarity:177/476 (37%) Gaps:113/476 (24%)


  Fly    62 DKVATSQKIWYDKGIDELNEALRP-----QDLTYPKNVRIFVIQGIDGRDWAAFRFPTSDASRG- 120
            |::.:|.  |..:...:|.|.|..     .|:...|||.:.:..|:......|.|........| 
  Fly    35 DELLSSH--WLRQAQSQLRERLARTKDSIADVRQAKNVVMLLGDGLSITTLTAARILKGQRRGGR 97

  Fly   121 --NTNFIWDRFPHLARLKNSCSQQFPCQVASVSRALWLGIPLDKVPDNQQDCGRLFNATQGPISI 183
              :.....::||.....|..|..:.....|..:.|.:.|:........|...|...:      |:
  Fly    98 GEDAQLAVEQFPFSGLSKTYCIDEQTPDSACTATAYFGGVKTHSGTVGQSGSGERVD------SV 156

  Fly   184 LRQAQLAGLRTGFVTTQRIT--GPTGAALGNANGNFECDESMPLNSIKSGCQDIAQQLISDETGK 246
            |:.||.||..||.|||.|:|  .|.||....:....|.              :||:||:.:|.|:
  Fly   157 LQWAQRAGKATGVVTTTRLTDASPAGAYAHVSRRGEEL--------------EIARQLVEEEPGR 207

  Fly   247 FLNVLIGGGRQMLSSLVPNTKYDPVDEMLCESNDGRNLLKDWRNQKLKESKINRIIFDLIQRRDE 311
            .|||::|||               :.:...|..||::||..||     ||..|......::   |
  Fly   208 NLNVILGGG---------------LGKFADERRDGKDLLAQWR-----ESNPNGCFSRSLK---E 249

  Fly   312 LESLNSSSFDYLMGVMANGDLS----GNSKAPSLKLMVDKSLNVLTKYKQ----GYLLIV----- 363
            |.:...:: ..|:|:.::..:|    .:.:.|.|..|...::..|.:..|    ||.:.:     
  Fly   250 LRNCTDAT-GTLLGIFSDSHMSYHLAASKELPRLCDMAAAAIEKLERKSQEDGNGYFVFIEGGRI 313

  Fly   364 -----EQFIPSGIDKREQLQLLNDTLVNLHKDQDTLTLV-------------------------- 397
                 |..:...:|:..:.....:|::.:...:|||.:|                          
  Fly   314 DHGHHETRVGYALDEMVEFDAAVETVIQMTDPRDTLVVVTADHSHTLSMSGYAKRGTPILGMDAQ 378

  Fly   398 ----------LMTNAIYPKPSLDVS--EETETISLLPEIFNEAESEIQKRLHQMPSESLLFAQGP 450
                      .:..||....|||..  .|:.:.:|.|..:..:....:|.:|. ..:.::||.||
  Fly   379 QRDVNGVPYSTLNYAIGKWQSLDKDGRRESPSKTLSPTSYTPSYIHGRKGVHS-GEDVVVFAMGP 442

  Fly   451 KSSIFQGVRKETFLAHAISH 470
            :|.:|.||.::..|.|.:.:
  Fly   443 QSHLFGGVMEQNLLPHIMGY 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 87/403 (22%)
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 94/441 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455742
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.