DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and SPBC14F5.13c

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_596739.1 Gene:SPBC14F5.13c PomBaseID:SPBC14F5.13c Length:532 Species:Schizosaccharomyces pombe

Alignment Length:404 Identity:83/405 (20%)
Similarity:158/405 (39%) Gaps:131/405 (32%)


  Fly    17 KSTQVFLVAGTCLITVMVTLLCIGFMTRYEVENDVANVADVDYWKDKVATSQKIWYDKGIDE--- 78
            ::.:.::..|..||.|:.|::...|.:.::                          .||.:|   
pombe    22 RNWKTWIKHGILLILVLSTVIFFYFFSSHK--------------------------SKGTNEKPK 60

  Fly    79 -----LNEALRPQDLTYPKNVRIFVIQGIDGRDWAAFRFPT------SDASRGNTNFIWDRFPHL 132
                 :::.:.|..|:..::    .::.::.::  .:|.|.      |..:|.:::.|.|     
pombe    61 FVIMMVSDGMGPGSLSMTRS----FVETLNDKE--GYRLPLDEHLIGSSRTRSSSSLITD----- 114

  Fly   133 ARLKNSCSQQFPCQVASVSRALWLGIPLDKVPDNQQDCGRLFNATQGPISILRQAQLAGLRTGFV 197
               ..:.:..|.|...:.:.|:       .|.||::.||          :||..|:.||..||.|
pombe   115 ---SAAGATAFSCANKTYNGAV-------GVLDNEKPCG----------TILEAAKEAGYLTGIV 159

  Fly   198 TTQRITGPTGAAL-GNANGNFECDESMPLNSIKSGCQDIAQQLISD------ETGKFLNVLIGGG 255
            .|.|:|..|.|:. .:|...|                  .|.||::      ..|:.:::|.|||
pombe   160 VTSRVTDATPASFSAHAANRF------------------MQDLIAEYQVGMGPLGRSVDLLFGGG 206

  Fly   256 RQMLSSLVPNTKYDPVDEMLCESNDGRNLLKDWRNQKLKESKINRIIFDLIQRRDELESLNSSSF 320
               |.|.:|.:.|     ..|.| |..:|||..|.   ||.      |.::..|.:.:.|:::..
pombe   207 ---LCSFLPKSTY-----RSCRS-DNLDLLKYARK---KEG------FQILLNRTDFDELSNAQL 253

  Fly   321 DYLMGVMANGDLSGN-----SKAPSLKLMVDKSLNVLTK-----YKQGYLLIVEQFIPSGIDKRE 375
            . |:|:.::..||.:     ...|.|..||:.:|:||..     ..:|:.|::|   .|.||...
pombe   254 P-LLGLFSDYHLSYDIDYQPEVQPKLSEMVETALDVLLNATNEDTSKGFFLLIE---GSRIDMAS 314

  Fly   376 QLQLLNDTLVNLHK 389
            .   .||.:.::::
pombe   315 H---NNDPIAHVYE 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 67/281 (24%)
SPBC14F5.13cNP_596739.1 PhoA 3..495 CDD:224699 83/405 (20%)
ALP_like 60..487 CDD:304875 74/341 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.970

Return to query results.
Submit another query.