DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and ALPP

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001623.3 Gene:ALPP HGNCID:439 Length:535 Species:Homo sapiens

Alignment Length:521 Identity:129/522 (25%)
Similarity:226/522 (43%) Gaps:115/522 (22%)


  Fly    26 GTCLITVMVTL-----LCIGFMTRYEVENDVANVADVDYWKDKVATSQKIWYDKGIDELNEA--L 83
            |.|::.:::.|     |.:|.:. .|.||.       |:|..:.|           :.|..|  |
Human     3 GPCMLLLLLLLGLRLQLSLGIIP-VEEENP-------DFWNREAA-----------EALGAAKKL 48

  Fly    84 RPQDLTYPKNVRIFVIQGIDGRDWAAFRF---PTSDASRGNTNFIWDRFPHLARLKN-SCSQQFP 144
            :|.. |..||:.||:..|:......|.|.   ...|..........||||::|..|. :..:..|
Human    49 QPAQ-TAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVP 112

  Fly   145 CQVASVSRALWLGIPLDKVPDNQQDCG-------RLFNATQG--PISILRQAQLAGLRTGFVTTQ 200
            ...|:.:..|.      .|..|.|..|       ...|.|:|  .||::.:|:.||...|.|||.
Human   113 DSGATATAYLC------GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTT 171

  Fly   201 RI--TGPTGAALGNANGNFECDESMPLNSIKSGCQDIAQQLISDETGKFLNVLIGGGRQMLSSL- 262
            |:  ..|.|......|.|:..|..:|.::.:.||||||.||||:..   ::|::||||:.:..: 
Human   172 RVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMD---IDVILGGGRKYMFRMG 233

  Fly   263 VPNTKYDPVDEMLCESN-DGRNLLKDWRNQKLKESKINRIIFDLIQRRDELESLNSSSFDYLMGV 326
            .|:.:| |.|.....:. ||:||:::|    |.:.:..|.:::   |.:.:::....|..:|||:
Human   234 TPDPEY-PDDYSQGGTRLDGKNLVQEW----LAKRQGARYVWN---RTELMQASLDPSVTHLMGL 290

  Fly   327 MANGDLS-----GNSKAPSLKLMVDKSLNVLTKYKQGYLLIVE-QFIPSGIDKREQLQLLNDTLV 385
            ...||:.     .::..|||..|.:.:|.:|::..:|:.|.|| ..|..|..:....:.|.:|::
Human   291 FEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIM 355

  Fly   386 ---------NLHKDQDTLTLV--------------LMTNAIY---PKPSLDVS------------ 412
                     .|..::|||:||              |..::|:   |..:.|..            
Human   356 FDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG 420

  Fly   413 ---------EETETISLLPEIFNEAESEIQKRLHQMPSESLLFAQGPKSSIFQGVRKETFLAHAI 468
                     :.||:.|..||...::...:.:..| ...:..:||:||::.:..||:::||:||.:
Human   421 YVLKDGARPDVTESESGSPEYRQQSAVPLDEETH-AGEDVAVFARGPQAHLVHGVQEQTFIAHVM 484

  Fly   469 S 469
            :
Human   485 A 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 105/411 (26%)
ALPPNP_001623.3 PRK10518 28..478 CDD:236706 119/487 (24%)
Alk_phosphatase 55..490 CDD:278666 113/450 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21907772
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.900 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.