DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp13 and Alpi

Sequence 1:NP_649978.2 Gene:Alp13 FlyBaseID:FBgn0037786 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_073156.3 Gene:Alpi RGDID:2099 Length:540 Species:Rattus norvegicus

Alignment Length:525 Identity:120/526 (23%)
Similarity:209/526 (40%) Gaps:136/526 (26%)


  Fly    34 VTLLCIGF-------MTRYEVENDVANVADVDYWKDKVATSQKIWYDKGIDELNEALRPQDL-TY 90
            |.||.:|.       :...|.||.|                  .|..|..:.|:.|.:.|.: |.
  Rat     6 VLLLLLGLRIHLSFGVIPVEEENPV------------------FWNQKAKEALDVAKKLQPIQTS 52

  Fly    91 PKNVRIFVIQGIDGRDWAAFRFPTSDASR-----------GNTNFIWDRFPHLARLKN-SCSQQF 143
            .||:.:|:..|:.        .||..|:|           ..|....|.||..|..|. :..:|.
  Rat    53 AKNLILFLGDGMG--------VPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQV 109

  Fly   144 PCQVASVSRALWLGIPLDKVPDNQQDCGRL--FNATQG--PISILRQAQLAGLRTGFVTTQRI-- 202
            | ..|..:.|...|:..:..........|.  .|:|.|  ..|::.:|:.||...|.|||.|:  
  Rat   110 P-DSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQH 173

  Fly   203 TGPTGAALGNANGNFECDESMPLNSIKSGCQDIAQQLISDETGKFLNVLIGGGRQ-MLSSLVPNT 266
            ..|.|......|.::..|..||.::::.||:|||.||||:..   ::|::||||: |.....|:.
  Rat   174 ASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMD---IDVILGGGRKFMFPKGTPDP 235

  Fly   267 KYDPVDEMLCESNDGRNLLKDWRNQKLKESKINRIIFDLIQRRDELESLNSSSFDYLMGVMANG- 330
            :|....:......|.|||:::|    |.:.:..|.:::   |...:::....:...|||:.... 
  Rat   236 EYPGDSDQSGVRLDSRNLVEEW----LAKYQGTRYVWN---REQLMQASQDPAVTRLMGLFEPAE 293

  Fly   331 ---DLSGNSKA-PSLKLMVDKSLNVLTKYKQGYLLIVE--------------------QFIPSGI 371
               |::.|:.| |||..|.:.::.:|::..||:.|.||                    ....|.|
  Rat   294 MKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAI 358

  Fly   372 DKREQLQLLNDTLVNLHKDQDTLTLV--------------LMTNAIYPKPSLDVSEETETISLL- 421
            :|..||.          .::|||||:              |...:|:....|:..:.....|:| 
  Rat   359 EKASQLT----------NEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILY 413

  Fly   422 -------------PEIFNEAESEI---QKRLHQMPSES------LLFAQGPKSSIFQGVRKETFL 464
                         |.:.:....::   |:....:.||:      .:||:||::.:..||:::.::
  Rat   414 GNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYI 478

  Fly   465 AHAIS 469
            ||.::
  Rat   479 AHVMA 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp13NP_649978.2 ALP_like 127..472 CDD:304875 97/414 (23%)
AlpiNP_073156.3 Alk_phosphatase 53..488 CDD:278666 106/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21929144
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.900 Consistency score
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.