DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eloF and CG31523

Sequence 1:NP_649956.1 Gene:eloF FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster

Alignment Length:246 Identity:78/247 (32%)
Similarity:124/247 (50%) Gaps:17/247 (7%)


  Fly    12 VVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLK 76
            ::|:|..|:...|.|..|...|||::|..|||..|..|:.:||..|.:::..|.     :.:::.
  Fly    29 LLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIF-----YEYLMS 88

  Fly    77 A----YQISCIVSLPMDHKYKD---RERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHH 134
            .    |.:.|   .|:|:....   |...||..|.::||.:..:|:||:||||:..:|.|||.||
  Fly    89 GWWGHYSLKC---QPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150

  Fly   135 FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQF 199
            ..|.|..::...| ..||.:....|||:.||::||.||.::::..:.|:.:|||||:|..|:|||
  Fly   151 GCMPFSVWMGLKF-APGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQF 214

  Fly   200 AIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKK 250
            ..|..| ...|....|...:......|.....|..:||.||...|:...::
  Fly   215 VAIFTH-QFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARR 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 78/247 (32%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62563320
eggNOG 1 0.900 E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11157
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.