DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9467 and T23B12.6

Sequence 1:NP_649952.1 Gene:CG9467 FlyBaseID:FBgn0037758 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_505177.1 Gene:T23B12.6 WormBaseID:WBGene00020721 Length:670 Species:Caenorhabditis elegans

Alignment Length:713 Identity:317/714 (44%)
Similarity:451/714 (63%) Gaps:101/714 (14%)


  Fly     2 SHFTHASSSD-LVNLNVGGQRFSTSRQTLTWIPDTFFTALLSGRISSLRDEHNAIFIDRDPTLFS 65
            |.|::.|.|| :|||||||:.|:||..|||||||:|||:|||||::|::|...||||||||.||.
 Worm     9 SSFSNDSGSDYIVNLNVGGRIFATSCNTLTWIPDSFFTSLLSGRMNSVKDPSGAIFIDRDPDLFR 73

  Fly    66 IILNYLRTKDIDIKNCEIRALRHEAEYYGITPLTKRLALCEDLNHSSCGDLLFYGFLAAPPMPSN 130
            :||||||||.:|:...::..|:|||.::|:|||.:||.|||:|:.:|||.:.|.|.:..|.||. 
 Worm    74 VILNYLRTKQVDLCGIKVDTLKHEALFFGLTPLIRRLTLCEELSSTSCGSVYFCGMIPPPDMPL- 137

  Fly   131 EAVAATSVDESLPSTSASAIGSRPGSMVRVPEPSRSSHSRNSSWDLRLGRTGSTGNGANPPAPML 195
                     |:||:                 |.|||....|||       ..||.|..|      
 Worm   138 ---------ENLPN-----------------EKSRSPMYSNSS-------ETSTNNSKN------ 163

  Fly   196 HSRNPSIDFMRHSRNSSADLNKVFRNEVG-LVFSPTQNSNWVDPLRVQIIKAHQNWIAVAYAHFV 259
             ..|.|.....||:..|.|:::..:||:. |..|.:|.....||::|::|:||...|.|||::||
 Worm   164 -KSNGSPRHRGHSKKQSTDMSRYIKNELSELAKSKSQPDRDTDPMKVRMIRAHICSIVVAYSYFV 227

  Fly   260 TCYRVKDSNGWQQVFTSPHIDATIERIAINSKVNTSAAEPLPSKMVAISY-GSQIRLWSIQEGGQ 323
            ..|||.:.|.:..::.||.....:..||:|:|:..:.||    ::||:|: ...|.||.|.:.|:
 Worm   228 CVYRVTEWNTYVLLWKSPRARTYVSHIAVNTKIAATVAE----RLVAVSFQDDTIGLWHIDDEGK 288

  Fly   324 KTDVGTFNLNVRVEYLFFIGSQLVALSSSGKIGVWHAMTQHWQIQDLVPVLSFDSAGSFLLLGCN 388
            ....|.|::||.::.|||:|:|:||||.|||:|:||:.||:||.||:.|:..:|:|||.|:|||.
 Worm   289 TEKKGLFSMNVSIDNLFFVGTQMVALSKSGKVGIWHSATQNWQAQDVQPISCYDTAGSSLILGCA 353

  Fly   389 NGSIYYIDMQKFPLRIKDNDLLVTELYKDVTLDPITAISVYLTPKTSSISGNWIEIAYGTKSGAV 453
            |||:.:|||||||||:||||||||||::|...:.||::||:||||||: .||||||||||.:|.|
 Worm   354 NGSMNHIDMQKFPLRMKDNDLLVTELFRDPNGETITSLSVFLTPKTSA-CGNWIEIAYGTSNGVV 417

  Fly   454 RIIVQHPETAGHGPHLFETFFVHQSPVTKVMLSEKYLVSVCSEYHHVRTWRLTRFRGMLSTQPGS 518
            .:|:||||||||.|.||:::.:|.|||.:|.|:..:|:||||||:|||:|.:||||||::||||:
 Worm   418 NLILQHPETAGHQPVLFQSYNIHNSPVQRVSLNTSHLISVCSEYNHVRSWNVTRFRGMINTQPGT 482

  Fly   519 TPEASFKIVSL----EATDTSYSYAAGNDFGPYGDYD-DMIFVQKVVPETDQLYVRLASNGDRVC 578
            .|.||||:::|    |.||..|::.     |||||.| :.:.:|:::|...:|:|||||.|:|:|
 Worm   483 VPLASFKVLTLDSIDETTDRQYNHP-----GPYGDQDSEQVLIQRLIPNAQKLFVRLASTGERIC 542

  Fly   579 VIRSVDSSTISAFCVLECE---VSSR---FILTGHCNGAIQMWDLTTAL---ALLSKDEPQQK-- 632
            .:.||:.|.|:||||.|.:   :.||   ::..|:.||::|:||||:||   .|.:...|||:  
 Worm   543 TVDSVEDSPITAFCVHELDGQKLGSRLRKYLFCGNGNGSVQVWDLTSALDQFHLKNGSHPQQQQV 607

  Fly   633 -----------------------IN-----GGPDTNELLRLLDQCEISNSSCTTPCMSPCLSA 667
                                   ||     |||...|||.::|..:|   .|:||.:|.|.||
 Worm   608 NPPAAANQSELIKPQLAQSPRSLINLSNYSGGPTPQELLDVIDDNDI---CCSTPSLSRCPSA 667

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9467NP_649952.1 BTB 13..107 CDD:197585 59/94 (63%)
BTB_2 13..105 CDD:280393 57/92 (62%)
T23B12.6NP_505177.1 BTB 21..115 CDD:197585 59/94 (63%)
BTB_2 21..113 CDD:280393 57/92 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C241822229
eggNOG 1 0.900 E1_KOG2714
Hieranoid 1 1.000
Homologene 1 1.000 H9395
Inparanoid 1 1.050 566 1.000 Inparanoid score I580
Isobase 1 0.950 0 Normalized mean entropy S3430
OMA 1 1.010
OrthoDB 1 1.010 D176271at33208
OrthoFinder 1 1.000 FOG0002282
OrthoInspector 1 1.000 T475556
orthoMCL 1 0.900 OOG5_131458
Panther 1 1.100 LDO PTHR15859
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3478
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.