| Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024478.1 | Gene: | ref-2 / 183539 | WormBaseID: | WBGene00004335 | Length: | 315 | Species: | Caenorhabditis elegans |
| Alignment Length: | 272 | Identity: | 71/272 - (26%) |
|---|---|---|---|
| Similarity: | 113/272 - (41%) | Gaps: | 62/272 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 506 GRIRQYLCDICGK--SYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTI---RPDLNDHIRKCHT 565
Fly 566 GERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEE--CGKRFYRADALKNHQRIHTGEKPYSC 628
Fly 629 LF--CTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVAGGA 691
Fly 692 STSDVPSGSGFMSTEPSVAEMQYSITPEQQEEMVCVPIDEVNNSFFMSHYMQAVPMEEDGSGQHI 756
Fly 757 IVFEQPGQNMDM 768 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
| C2H2 Zn finger | 277..297 | CDD:275368 | |||
| C2H2 Zn finger | 431..453 | CDD:275368 | |||
| COG5048 | <450..647 | CDD:227381 | 49/149 (33%) | ||
| C2H2 Zn finger | 469..490 | CDD:275368 | |||
| zf-C2H2 | 511..533 | CDD:278523 | 4/23 (17%) | ||
| C2H2 Zn finger | 513..564 | CDD:275368 | 14/55 (25%) | ||
| C2H2 Zn finger | 541..561 | CDD:275368 | 7/22 (32%) | ||
| zf-H2C2_2 | 555..581 | CDD:290200 | 15/25 (60%) | ||
| C2H2 Zn finger | 572..592 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 585..609 | CDD:290200 | 9/25 (36%) | ||
| zf-C2H2 | 598..620 | CDD:278523 | 6/23 (26%) | ||
| C2H2 Zn finger | 600..620 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 612..637 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 628..646 | CDD:275368 | 6/19 (32%) | ||
| ref-2 | NP_001024478.1 | zf-H2C2_2 | 139..163 | CDD:290200 | 15/24 (63%) |
| COG5048 | 150..>227 | CDD:227381 | 28/76 (37%) | ||
| C2H2 Zn finger | 154..174 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 166..193 | CDD:290200 | 9/26 (35%) | ||
| C2H2 Zn finger | 182..204 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 212..234 | CDD:275368 | 6/21 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||