DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and ref-2

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001024478.1 Gene:ref-2 / 183539 WormBaseID:WBGene00004335 Length:315 Species:Caenorhabditis elegans


Alignment Length:272 Identity:71/272 - (26%)
Similarity:113/272 - (41%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 GRIRQYLCDICGK--SYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTI---RPDLNDHIRKCHT 565
            |::..::|...|:  ::..|:|:....:       |||..:.|||:|.:   :..|.:|:| .||
 Worm    91 GQVCMHVCQNSGELSTHISSNHITHDSK-------FVCLWKGCDREFKMFKAKYKLVNHMR-VHT 147

  Fly   566 GERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEE--CGKRFYRADALKNHQRIHTGEKPYSC 628
            ||||:||.||.|.|........|:.||.||:.::|..  |.|.|..:...|.|..:|:..|||||
 Worm   148 GERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSC 212

  Fly   629 LF--CTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVAGGA 691
            ::  |.||:.......||.:...:.           :|.||           :||..::..:|.|
 Worm   213 MYPDCGKTYTHPSSLRKHTKVHENE-----------KKSQL-----------SPEHDESSDSGNA 255

  Fly   692 STSDVPSGSGFMSTEPSVAEMQYSITPEQQEEMVCVPIDEVNNSFFMSHYMQAVPMEEDGSGQHI 756
            |.       |..:|:.|:.....:|..:|....:...:|..|.  ||..|...            
 Worm   256 SI-------GTPTTDESLTFSPENIKRDQHLHTMHTFMDRPNP--FMQMYQNQ------------ 299

  Fly   757 IVFEQPGQNMDM 768
              |..|..:|.|
 Worm   300 --FSNPTYHMFM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 49/149 (33%)
C2H2 Zn finger 469..490 CDD:275368
zf-C2H2 511..533 CDD:278523 4/23 (17%)
C2H2 Zn finger 513..564 CDD:275368 14/55 (25%)
C2H2 Zn finger 541..561 CDD:275368 7/22 (32%)
zf-H2C2_2 555..581 CDD:290200 15/25 (60%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 9/25 (36%)
zf-C2H2 598..620 CDD:278523 6/23 (26%)
C2H2 Zn finger 600..620 CDD:275368 6/21 (29%)
zf-H2C2_2 612..637 CDD:290200 11/26 (42%)
C2H2 Zn finger 628..646 CDD:275368 6/19 (32%)
ref-2NP_001024478.1 zf-H2C2_2 139..163 CDD:290200 15/24 (63%)
COG5048 150..>227 CDD:227381 28/76 (37%)
C2H2 Zn finger 154..174 CDD:275368 6/19 (32%)
zf-H2C2_2 166..193 CDD:290200 9/26 (35%)
C2H2 Zn finger 182..204 CDD:275368 6/21 (29%)
C2H2 Zn finger 212..234 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.