DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and tra-1

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001022880.2 Gene:tra-1 / 176548 WormBaseID:WBGene00006604 Length:1110 Species:Caenorhabditis elegans


Alignment Length:651 Identity:131/651 - (20%)
Similarity:194/651 - (29%) Gaps:287/651 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 GEMLIDNDPA-----FATSN--QNTNPPKKEMFSSLIL------GSVLQCEFCEYIFADIAELLV 377
            |::..:|||:     .||||  |::.||..:..|:.:.      .||.|......:|......|.
 Worm    53 GDVKTENDPSKNGLGSATSNFIQSSVPPSHQTLSNPLQLSPPAEASVAQQSGASQVFPTFQAALG 117

  Fly   378 HSASHVAERRFECTACDIQMN-TAKEASIHFQTDCIFMREAIRSLNVTLSRYFVCNVCELKFAN- 440
            .|:..:           :|.| |:...|....|..|                    |..:||.| 
 Worm   118 ASSDEL-----------LQPNATSSSTSSSASTSSI--------------------VPVVKFTNQ 151

  Fly   441 TDLLQEHRCTSFHYFPRLNENGKKLLLP------------------------------CDF--CD 473
            |........||.....||..|||::..|                              |.:  |:
 Worm   152 TAPNGSTVATSVGQNVRLTINGKRVGRPPGTFKRPQNNAANSSNSGNDSDMMGDHDLTCRWKSCN 216

  Fly   474 VNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKP 538
            .:|:.....:.|.:|.|:                          :|..|..|.|:          
 Worm   217 SSFQTLKALVDHVQESHV--------------------------QSTEQEHHAWR---------- 245

  Fly   539 FVCQEENCDRKFTIRP--DLNDHIRKCHTGERPYLCLV--CGKRFLTGSVFYQHRLIHRGERRYE 599
              |:.|.|||..|.:.  .|..|:|: ||||:|..|..  |||.:........||..|.||:.|:
 Worm   246 --CEWEGCDRNETFKALYMLIVHVRR-HTGEKPNKCEYPGCGKEYSRLENLKTHRRTHTGEKPYK 307

  Fly   600 CE--ECGKRFYRA-DALKNHQRIHTGEKPYSCLF--CTKTFRQRGDRDKHIRARH---------- 649
            ||  :|.|.|..| |..|:..|.|:..|||||..  |||::.......|||:|.|          
 Worm   308 CEFADCEKAFSNASDRAKHQNRTHSNLKPYSCQIPQCTKSYTDPSSLRKHIKAVHGDDEYEKAKK 372

  Fly   650 ----------------------------------------------------------------- 649
                                                                             
 Worm   373 SRPANYSNRRRPDHRLAPPTGAMSHPYLATPNSGASVVAHSSVHQQNFINMALAQHHHNAQRAQQ 437

  Fly   650 ------------------------SHLDANSRLMM--QMQKFQLETAAAQKA--------QSHNP 680
                                    :|..|.::::.  .||:.|::.||..:|        |:|..
 Worm   438 LMAATGNVMPMMDPASAAAAAQAQAHHQAQAQMLQTHMMQQAQIQAAAQMQAQVQHQAAMQAHAM 502

  Fly   681 EQQ----DNDVAGGAS----------TSDVPSGSGFMSTEP---SVAEMQYSIT----------- 717
            :|.    .|::.|..|          .|..|:....:.|.|   |||.|...:|           
 Worm   503 QQAQMVLQNNLLGAQSLLSPFSPLLPPSRAPNVMAMLQTPPTPTSVAPMFDIMTSRAPMAPVVSA 567

  Fly   718 PEQQEEMVCVPIDEVNNSFFMSHYMQAVPMEEDGSGQHIIVFEQPGQNMDMMSIYDQQQVGEPMH 782
            |.....:|..|:             .|.|           ||::..:.|..:....|||..|||.
 Worm   568 PTAPAPLVPAPV-------------PASP-----------VFDELREQMREVEPLQQQQQQEPMD 608

  Fly   783 E 783
            :
 Worm   609 Q 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 7/22 (32%)
COG5048 <450..647 CDD:227381 63/237 (27%)
C2H2 Zn finger 469..490 CDD:275368 5/22 (23%)
zf-C2H2 511..533 CDD:278523 4/21 (19%)
C2H2 Zn finger 513..564 CDD:275368 13/52 (25%)
C2H2 Zn finger 541..561 CDD:275368 8/21 (38%)
zf-H2C2_2 555..581 CDD:290200 12/27 (44%)
C2H2 Zn finger 572..592 CDD:275368 6/21 (29%)
zf-H2C2_2 585..609 CDD:290200 11/25 (44%)
zf-C2H2 598..620 CDD:278523 10/24 (42%)
C2H2 Zn finger 600..620 CDD:275368 9/22 (41%)
zf-H2C2_2 612..637 CDD:290200 11/26 (42%)
C2H2 Zn finger 628..646 CDD:275368 6/19 (32%)
tra-1NP_001022880.2 COG5048 <177..358 CDD:227381 54/219 (25%)
C2H2 Zn finger 246..270 CDD:275368 9/24 (38%)
SFP1 <272..362 CDD:227516 35/89 (39%)
C2H2 Zn finger 278..300 CDD:275368 6/21 (29%)
zf-H2C2_2 292..319 CDD:316026 11/26 (42%)
C2H2 Zn finger 308..331 CDD:275368 9/22 (41%)
C2H2 Zn finger 339..362 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.