DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and ZNF746

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001381127.1 Gene:ZNF746 / 155061 HGNCID:21948 Length:660 Species:Homo sapiens


Alignment Length:157 Identity:45/157 - (28%)
Similarity:65/157 - (41%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 KSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHT--GERP----------- 569
            |.:.....|.:|.....|.:||.|  ..|.:.|.::..|:.|.|.|..  |..|           
Human   448 KGFGHKPGLKKHPAAPPGGRPFTC--ATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGSGSGG 510

  Fly   570 ---------------YLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRI 619
                           ..|..||:.|...:...:||::|.|||.:.|.||.|||.....|.:|.|.
Human   511 GGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRT 575

  Fly   620 HTGEKPYSCLFCTKTFRQRGDRDKHIR 646
            |||.:|::|..|.|:|.::....||.|
Human   576 HTGVRPFTCTVCGKSFIRKDHLRKHQR 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 45/157 (29%)
C2H2 Zn finger 469..490 CDD:275368
zf-C2H2 511..533 CDD:278523 3/14 (21%)
C2H2 Zn finger 513..564 CDD:275368 12/45 (27%)
C2H2 Zn finger 541..561 CDD:275368 5/19 (26%)
zf-H2C2_2 555..581 CDD:290200 10/53 (19%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 12/23 (52%)
zf-C2H2 598..620 CDD:278523 9/21 (43%)
C2H2 Zn finger 600..620 CDD:275368 9/19 (47%)
zf-H2C2_2 612..637 CDD:290200 11/24 (46%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
ZNF746NP_001381127.1 DUF3669 25..81 CDD:403575
KRAB 111..171 CDD:214630
zf-C2H2_11 522..548 CDD:406917 6/25 (24%)
C2H2 Zn finger 528..548 CDD:275368 6/19 (32%)
zf-H2C2_2 540..564 CDD:404364 11/23 (48%)
C2H2 Zn finger 556..576 CDD:275368 9/19 (47%)
zf-H2C2_2 569..593 CDD:404364 11/23 (48%)
zf-C2H2 582..604 CDD:395048 7/21 (33%)
C2H2 Zn finger 584..604 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.