DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and znf1040

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_017211075.1 Gene:znf1040 / 101884948 ZFINID:ZDB-GENE-141210-11 Length:420 Species:Danio rerio


Alignment Length:489 Identity:118/489 - (24%)
Similarity:163/489 - (33%) Gaps:130/489 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KPIEVAVPQQEKPHLVPTVSAPPAPLSKPASERVIRENQVRLRRYIKDEMKYDLATGIESSRKNA 223
            ||.|:..  .|||.|....|:...|                                    ||:.
Zfish    51 KPQEIMT--DEKPTLTKKTSSHGRP------------------------------------RKSK 77

  Fly   224 AKGPNECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGRIFYDPQ 288
            :.....|..|.:.|...|.|..||..|        |.|||.|           |..||:.|...|
Zfish    78 SGCNFSCKQCSKSFSQKSKLDVHMRVH--------TREQPFT-----------CEQCGKSFGQKQ 123

  Fly   289 VAFRHGLIHDSEHS-TMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQNTNPPKKEMFS 352
            ....|..||..:.. |.:|...:...:.....:..:..||                     :.||
Zfish   124 GFKAHMRIHTGKRKFTCQQCGKSFYHAGNFAAHMRIHTGE---------------------KPFS 167

  Fly   353 SLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNTAKEASIHFQTDCIFMREA 417
                     |:.|...|.....|.||...|..|:.:.|..|.......:..:.|.:..       
Zfish   168 ---------CKQCGKSFCHKPNLDVHMRVHTGEKPYTCEQCGRSFGQKQSFNTHMRIH------- 216

  Fly   418 IRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFCDVNFEFAHDF 482
                  |..|...|..||..|.|...|..|..|.....|          ..|..|..:|......
Zfish   217 ------TGKRPCTCQQCEKSFYNARSLAAHMITHTGERP----------FSCILCGKSFSLKLTL 265

  Fly   483 LAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCD 547
            :|     |:....|||           .::|:.||||:.|...|..|:|.|.|.||:.|.|  |.
Zfish   266 IA-----HMRVHTREK-----------PHICEQCGKSFGQKQDLDIHMRIHTGEKPYTCTE--CG 312

  Fly   548 RKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADA 612
            :.|.....|..||| .||||:|:.|..|||.|.|.:....|...|.|...:.|::|||...|.|:
Zfish   313 KSFPHISSLKHHIR-THTGEKPFTCAQCGKSFTTKTSLKNHMNGHTGTIVFTCDQCGKSLTRKDS 376

  Fly   613 LKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIR 646
            :..|.:||:.|..:.|..|.|.|:.:...:.|::
Zfish   377 ITKHMKIHSREDRFRCSECGKGFKSKRSLNTHMK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..453 CDD:275368 8/21 (38%)
COG5048 <450..647 CDD:227381 60/197 (30%)
C2H2 Zn finger 469..490 CDD:275368 4/20 (20%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 21/50 (42%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 14/25 (56%)
C2H2 Zn finger 572..592 CDD:275368 7/19 (37%)
zf-H2C2_2 585..609 CDD:290200 7/23 (30%)
zf-C2H2 598..620 CDD:278523 7/21 (33%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 8/24 (33%)
C2H2 Zn finger 628..646 CDD:275368 5/17 (29%)
znf1040XP_017211075.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.