DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and AT1G75280

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_565107.1 Gene:AT1G75280 / 843865 AraportID:AT1G75280 Length:310 Species:Arabidopsis thaliana


Alignment Length:237 Identity:54/237 - (22%)
Similarity:93/237 - (39%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSK---------VELVKGDVTNYED 58
            :|.:|||||..|:..|:.:.:.|.|...|.| |.|:.:..|.|         |.::.||:.::|.
plant     7 KILVIGGTGYIGKFLVEASAKAGHSTFALVR-EATLSDPVKGKTVQSFKDLGVTILHGDLNDHES 70

  Fly    59 VQRVIEGVDAVAVILGTRNKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVPTVF 123
            :.:.|:.||.|...:|:...|:.|        .:|.|:|||...|      .||       |:.|
plant    71 LVKAIKQVDVVISTVGSMQILDQT--------KIISAIKEAGNVK------RFL-------PSEF 114

  Fly   124 HRLNEEHQRMLDLTKACDLDWIAI-----------------------LP------PHIADEPATA 159
             .::.:....::..|:.....|.|                       ||      |.:...|...
plant   115 -GVDVDRTSAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDK 178

  Fly   160 YTVLHDEAPGRLVSK-YDLGKFIIDSLEQPEHYRKVCGIGKS 200
            .|:|.|.....:::| .|:..:.|.:::.|....|:..|..|
plant   179 VTILGDGNAKAVINKEEDIAAYTIKAVDDPRTLNKILYIKPS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 52/232 (22%)
WcaG 3..>110 CDD:223528 33/115 (29%)
AT1G75280NP_565107.1 NmrA 8..240 CDD:398829 54/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.