DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and BAN

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_176365.1 Gene:BAN / 842469 AraportID:AT1G61720 Length:340 Species:Arabidopsis thaliana


Alignment Length:157 Identity:35/157 - (22%)
Similarity:65/157 - (41%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QRIAIIGGTGMTGECAVDHALQKGLSVKLLYR---SEKTVPERFK----SKVELVKGDVTNYEDV 59
            ::..:|||||......:.|.||.|..|....|   :||.:....|    ..:::.|.|:|:.:..
plant    11 KKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSF 75

  Fly    60 QRVIEGVDAVAVILGTRNKLEATTELS------RGTENLIKAMKEAKLTKFSIVMSSFLLRPLNE 118
            :....|.:.:..:....|......|..      :|..|::|:..::|..|..|..||.....:|.
plant    76 ESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINN 140

  Fly   119 VPTVFHRLNEEHQRMLD-LTKACDLDW 144
            :......:|||:...:: ||:....:|
plant   141 LSGTGIVMNEENWTDVEFLTEEKPFNW 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 35/156 (22%)
WcaG 3..>110 CDD:223528 26/119 (22%)
BANNP_176365.1 PLN00198 2..339 CDD:215100 35/157 (22%)
FR_SDR_e 14..314 CDD:187661 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.