powered by:
Protein Alignment CG9471 and AT1G16770
DIOPT Version :9
| Sequence 1: | NP_001097729.1 |
Gene: | CG9471 / 41197 |
FlyBaseID: | FBgn0037749 |
Length: | 204 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_173121.1 |
Gene: | AT1G16770 / 838248 |
AraportID: | AT1G16770 |
Length: | 324 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 63 |
Identity: | 17/63 - (26%) |
| Similarity: | 32/63 - (50%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 LQKGLSVKLLYRSEKTVPERFKSK------VELVKGDVTNYEDVQRVIEGVDAVAVILGTRNK 78
::|.|.::.:...:|::|:..|.. ||:| .||.|||:..::|.:......|.|:|
plant 102 IEKQLLLRFIVMGKKSLPDPSKKSQPFWGFVEMV---TTNVEDVKNALKGEEYETKTRGHRHK 161
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.