DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and AT5G02240

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_568098.1 Gene:AT5G02240 / 830851 AraportID:AT5G02240 Length:253 Species:Arabidopsis thaliana


Alignment Length:244 Identity:49/244 - (20%)
Similarity:90/244 - (36%) Gaps:62/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKG---LSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQRVIEG 65
            :.:.|.:|.||: .|...|::|   ...|.|.||.:. .|:...:.::..||:|:.:.:....:|
plant     7 VLVTGASGRTGQ-IVYKKLKEGSDKFVAKGLVRSAQG-KEKIGGEADVFIGDITDADSINPAFQG 69

  Fly    66 VDAVAVILGTRNKLEATTELSR--------------------GTENLIKAMKEAKLTKFSIVMSS 110
            :||:.::.....|::...:.::                    |.:|.|.|.|.|.:....:|.|.
plant    70 IDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSM 134

  Fly   111 FLLRPLNEVPTVFHRLNEEHQRMLDLTKACDLDWIAILPPHIADEPATAYTVLH-----DEAPG- 169
            ....|       .|.||:       |.....|.|......::||. .|.||::.     |:..| 
plant   135 GGTNP-------DHPLNK-------LGNGNILVWKRKAEQYLADS-GTPYTIIRAGGLLDKEGGV 184

  Fly   170 ----------------RLVSKYDLGKFIIDSLEQPEHYRKVCGIGKSPK 202
                            :.|.:.|:.:..|.:|...|...|...:|..|:
plant   185 RELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 47/237 (20%)
WcaG 3..>110 CDD:223528 26/128 (20%)
AT5G02240NP_568098.1 SDR_a5 6..231 CDD:187554 48/240 (20%)
Epimerase 7..229 CDD:279681 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2659
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.