DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and FLDH

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_195062.1 Gene:FLDH / 829473 AraportID:AT4G33360 Length:344 Species:Arabidopsis thaliana


Alignment Length:212 Identity:50/212 - (23%)
Similarity:81/212 - (38%) Gaps:57/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQRVIEGVD 67
            :|.:.|.||..|.......|::|.||:.|.|....:.: ...:|||..||||:|..:.....|.|
plant    14 KILVTGSTGYLGARLCHVLLRRGHSVRALVRRTSDLSD-LPPEVELAYGDVTDYRSLTDACSGCD 77

  Fly    68 AV------------------AVILGTRNKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFL-- 112
            .|                  :|.:|             |.:|:::|:||.|..:..|..|||.  
plant    78 IVFHAAALVEPWLPDPSRFISVNVG-------------GLKNVLEAVKETKTVQKIIYTSSFFAL 129

  Fly   113 ------LRPLNEVPTVFHRLNE-----EHQRMLDLTKACDLDWIAILPPHIADEPATAYTVLHDE 166
                  :...|:|    |  ||     |::|...:.....|:..:...|.|...|...:      
plant   130 GSTDGSVANENQV----H--NERFFCTEYERSKAVADKMALNAASEGVPIILLYPGVIF------ 182

  Fly   167 APGRLVSKYDLGKFIID 183
            .||:|.|...:.:.:|:
plant   183 GPGKLTSANMVARMLIE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 50/212 (24%)
WcaG 3..>110 CDD:223528 31/124 (25%)
FLDHNP_195062.1 AR_FR_like_1_SDR_e 15..336 CDD:187539 50/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.