DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and AT4G18810

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001190764.1 Gene:AT4G18810 / 827615 AraportID:AT4G18810 Length:627 Species:Arabidopsis thaliana


Alignment Length:169 Identity:44/169 - (26%)
Similarity:73/169 - (43%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVKGDVT--------NYEDVQ 60
            |.:.|.||..|...||...::||.||.|.|:|:...:....:::|:..|:|        .::.|:
plant   125 ILVAGATGGVGRRIVDILRKRGLPVKALVRNEEKARKMLGPEIDLIVADITKENTLVPEKFKGVR 189

  Fly    61 RVIEGVDAVAVILG-------TRNKLEA------------TTELSR--GTENLIKAMKE------ 98
            :||   :||:||:|       .|.|...            :.||..  |.:|||.|:::      
plant   190 KVI---NAVSVIVGPKEGDTPERQKYNQGVRFFEPEIKGDSPELVEYIGMKNLINAVRDGVGLEN 251

  Fly    99 AKLTKFSIVMSSFLLRPLNEVPTVFHRLNEEHQRMLDLT 137
            .||. |.:..::|...|...:..|......|...::|||
plant   252 GKLI-FGVGDNTFKDLPWGALDDVVMGGVSESNFIVDLT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 44/169 (26%)
WcaG 3..>110 CDD:223528 37/140 (26%)
AT4G18810NP_001190764.1 NADB_Rossmann 125..>242 CDD:304358 33/119 (28%)
YbjT 125..>210 CDD:223774 25/87 (29%)
CIA30 268..428 CDD:285718 5/22 (23%)
NADB_Rossmann <442..549 CDD:304358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.