DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and PTAC16

DIOPT Version :8

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_566886.2 Gene:PTAC16 / 823831 AraportID:AT3G46780 Length:510 Species:Arabidopsis thaliana

Alignment Length:192 Identity:40/193 (21%)
Similarity:72/193 (37%) Gaps:41/193 (21%)


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPE--------RFKSKVELVKGD-VTNYEDV 59
            |.:.|.||..|.......||:|.||:      ..||:        |..:..:::..| |.....|
plant    94 IFVAGATGQAGIRIAQTLLQRGFSVR------AGVPDLGAAQDLARVAATYKILSNDEVKRLNAV 152

  Fly    60 QRVIEGVDAVAVILGTRNKLEATTELSRGTEN-------------LIKAMKEAKLTKFSIV---- 107
            |...:..:::|..:|...|:..|.   ..|||             :::|.:.|.::..:||    
plant   153 QSPFQDAESIAKAIGNATKVVVTV---GATENGPDAQVSTSDALLVVQAAELAGVSHVAIVYDGT 214

  Fly   108 MSSFLLRPLNEVPTVFHRLNEEHQ-----RMLDLTKACDLDWIAILPPHIAD-EPATAYTVL 163
            :|......|:.:.:.|..|..:.|     .:::.....|:.:..|......| .|..||.|:
plant   215 ISGSTYNVLDGITSFFGNLFAKSQPLTISDLIEKVAQTDVAYTLIKTSLTEDFSPEKAYNVV 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 40/193 (21%)
WcaG 3..>110 CDD:223528 29/132 (22%)
PTAC16NP_566886.2 NADB_Rossmann 93..322 CDD:304358 40/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.