DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and BLVRB

DIOPT Version :8

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_000704.1 Gene:BLVRB / 645 HGNCID:1063 Length:206 Species:Homo sapiens

Alignment Length:192 Identity:74/193 (38%)
Similarity:107/193 (55%) Gaps:2/193 (1%)


  Fly     1 MQRIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQRVIEG 65
            :::|||.|.||.||...:..|:|.|..|.:|.|....:|........:|.|||....||.:.:.|
Human     3 VKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAG 67

  Fly    66 VDAVAVILGTRNKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVPTVFHRLNEEH 130
            .|||.|:|||||.|..||.:|.|..|::.|||...:.|.....|:|||....:||.....:.::|
Human    68 QDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH 132

  Fly   131 QRMLDLTKACDLDWIAILPPHIADEPAT-AYTV-LHDEAPGRLVSKYDLGKFIIDSLEQPEH 190
            .||..:.:...|.::|::||||.|:|.| |||| |....|.|::||:|||.|::..|...|:
Human   133 IRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEY 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 74/191 (39%)
WcaG 3..>110 CDD:223528 42/107 (39%)
BLVRBNP_000704.1 BVR-B_like_SDR_a 5..200 CDD:187555 74/191 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209855048
eggNOG 1 0.900 E1_2A5J3
Hieranoid 1 1.000
Homologene 1 1.000 H573
Inparanoid 1 1.050 133 1.000 Inparanoid score I4527
Isobase 1 0.950 0 Normalized mean entropy S6863
OMA 1 1.010
OrthoDB 1 1.010 D1166292at2759
OrthoFinder 1 1.000 FOG0008020
OrthoInspector 1 1.000 T1074111
orthoMCL 1 0.900 OOG5_131746
Panther 1 1.100 LDO PTHR43355
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5444
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.