DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and blvrb

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001002686.1 Gene:blvrb / 436959 ZFINID:ZDB-GENE-030131-1516 Length:192 Species:Danio rerio


Alignment Length:188 Identity:78/188 - (41%)
Similarity:107/188 - (56%) Gaps:3/188 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQRVIEGVDAVAVILGTR 76
            |||...:..|:..|.:|.:|.|....:|...|:. .:|.|||.|..||::.:||.|||.:|||||
Zfish     1 MTGLATLPIAVASGYNVTVLVRDPARLPPDHKAS-RVVVGDVLNKNDVKKTLEGQDAVIIILGTR 64

  Fly    77 NKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVPTVFHRLNEEHQRMLDLTKACD 141
            |.|..||.:|.||.|:::.||...:.|....||:|||...::||.....:.|:|.||..:.|...
Zfish    65 NDLSPTTMMSEGTRNIVEVMKARGIRKVVGCMSAFLLWDRSKVPPRLVPVTEDHDRMYTVLKESG 129

  Fly   142 LDWIAILPPHIA-DEPAT-AYTVLHDEAPGRLVSKYDLGKFIIDSLEQPEHYRKVCGI 197
            ||:||.:||||| |:|.| .|.|..:...||::||||||.|.:..|...|...|..||
Zfish   130 LDYIAAMPPHIAGDKPLTEKYIVTENMLKGRVISKYDLGHFFVKCLSTSEWDGKTVGI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 76/186 (41%)
WcaG 3..>110 CDD:223528 39/97 (40%)
blvrbNP_001002686.1 BVR-B_like_SDR_a 1..187 CDD:187555 76/186 (41%)
WcaG 11..>158 CDD:223528 60/147 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595915
Domainoid 1 1.000 132 1.000 Domainoid score I5093
eggNOG 1 0.900 - - E1_2A5J3
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H573
Inparanoid 1 1.050 141 1.000 Inparanoid score I4477
OMA 1 1.010 - - QHG50219
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 1 1.000 - - FOG0006648
OrthoInspector 1 1.000 - - oto40769
orthoMCL 1 0.900 - - OOG6_102768
Panther 1 1.100 - - LDO PTHR43355
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5444
SonicParanoid 1 1.000 - - X5659
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.