DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and hspa9

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001001229.1 Gene:hspa9 / 407910 XenbaseID:XB-GENE-960228 Length:670 Species:Xenopus tropicalis


Alignment Length:238 Identity:54/238 - (22%)
Similarity:86/238 - (36%) Gaps:91/238 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AIIG-GTGMTGECAVDHALQKGLSVKLLYRSE--KTVPE--RFKSKVELVKGDVTNYEDVQRVIE 64
            |:|| ..|.|..|.   |:.:|...|:|..||  :|.|.  .|.|             |.:|:: 
 Frog    48 AVIGIDLGTTNSCV---AIMEGKQAKVLENSEGARTTPSVVAFSS-------------DAERLV- 95

  Fly    65 GVDAVAVILGTRNKLEATTELSR---GTENLI-------KAMKEAKLTKFSIVMSS--------- 110
                     |...|.:|.|..:.   .|:.||       :..|:.|...|.||.:|         
 Frog    96 ---------GMPAKRQAVTNPNNTFYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLESH 151

  Fly   111 -----------FLLRPLNE----------------VPTVFHRLNEEHQRMLDLTKACDLDWIAIL 148
                       |:|..:.|                ||..|:  :.:.|...|..:...|:.:.::
 Frog   152 GKLYSPSQIGAFVLMKMKETAENYLGHAAKNAVITVPAYFN--DSQRQATKDAGQISGLNVLRVI 214

  Fly   149 PPHIADEP---ATAYTVLHDEAPGRLVSKYDL--GKFIIDSLE 186
                 :||   |.||.:  |::..::::.|||  |.|.|..||
 Frog   215 -----NEPTAAALAYGL--DKSDDKIIAVYDLGGGTFDISILE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 54/238 (23%)
WcaG 3..>110 CDD:223528 30/119 (25%)
hspa9NP_001001229.1 dnaK 46..664 CDD:234715 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165177568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.