DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and Nsdhl

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_035071.3 Gene:Nsdhl / 18194 MGIID:1099438 Length:362 Species:Mus musculus


Alignment Length:168 Identity:36/168 - (21%)
Similarity:66/168 - (39%) Gaps:59/168 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QRIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKS-KVELVKGDVTNYEDVQRVIEG 65
            ::..:|||:|..|:..|:..|::|.:|.:.     .:.:.|.: :|:...||:.|.:|:...::|
Mouse    27 KKCTVIGGSGFLGQHMVEQLLERGYTVNVF-----DIHQGFDNPRVQFFIGDLCNQQDLYPALKG 86

  Fly    66 VDAV------------------AVILGTRNKLEATTE--------------------LSRGTENL 92
            |..|                  ...:||:..:|...|                    :..|||:|
Mouse    87 VSTVFHCASPPPYSNNKELFYRVNFIGTKTVIETCREAGVQKLILTSSASVVFEGVDIKNGTEDL 151

  Fly    93 IKAMK------EAKLTKFSIVM------SSFL---LRP 115
            ..|||      |.|:.:...|:      .:||   :||
Mouse   152 PYAMKPIDYYTETKILQERAVLDANDPKKNFLTAAIRP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 36/167 (22%)
WcaG 3..>110 CDD:223528 32/157 (20%)
NsdhlNP_035071.3 3b-HSD-NSDHL-like_SDR_e 29..355 CDD:187673 36/166 (22%)
3Beta_HSD 31..281 CDD:279420 36/164 (22%)
Prevents secretion from ER. /evidence=ECO:0000269|PubMed:14506130 359..362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.