DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and C32D5.12

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_495280.1 Gene:C32D5.12 / 174053 WormBaseID:WBGene00016319 Length:357 Species:Caenorhabditis elegans


Alignment Length:71 Identity:17/71 - (23%)
Similarity:34/71 - (47%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRIAIIGGTGMTGECAVDHALQKG--LSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQRVI 63
            |..:|:.||.|:.|...|...|:..  ..::::.|...:..|  ..||:|.:.|:.:.:.::..:
 Worm     1 MYTVAVTGGAGLVGRYVVQRLLENEQIAEIRIIDRQSTSRDE--SRKVKLYQIDLNDRKSLENAL 63

  Fly    64 EGVDAV 69
            .|.|.|
 Worm    64 RGCDGV 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 16/69 (23%)
WcaG 3..>110 CDD:223528 16/69 (23%)
C32D5.12NP_495280.1 MupV_like_SDR_e 4..326 CDD:187573 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.