DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and Fcrls

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_109632.2 Gene:Fcrls MGIID:1933397 Length:509 Species:Mus musculus

Alignment Length:351 Identity:77/352 (22%)
Similarity:128/352 (36%) Gaps:91/352 (26%)


  Fly     7 FMLALQLIESSIGSKDVPIHQ-----------IESIVGENIYLPCNVTTYDGDEPVLVLWYRDDK 60
            |.|.:...|.: |||.:.:.:           ::.:.|.::.|.||.            |...|:
Mouse    88 FFLFIDTTEET-GSKWLNVQELFPAPGLTASPLQPVEGSSVTLSCNT------------WLPSDR 139

  Fly    61 GTP--IYSI-----DIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRV 118
            .|.  .||.     .:::|       |:.                .|.:|......|||.|.|..
Mouse   140 ATTQLRYSFFKDGHTLQSG-------WTS----------------SKFTISAISKEDSGNYWCEA 181

  Fly   119 DFLKAQTINSRIRLNVIS----PPKQVIIRDSSN----VERSTVVGPYSEGDIVSLKCQVIGGYP 175
             ...:::::.:...:.|.    |..||.:....:    ||...:|   .||:.:.|.|.|..|..
Mouse   182 -MTASRSVSKQSHRSYIDVERIPVSQVTMEIQPSRGWGVEGEPLV---VEGEPLVLACSVAKGTG 242

  Fly   176 TPTISWYRDGIEIPCELSHLAGGKI-----IECEITLPSLGREDLNSRLTCRALSHPRAPIVEAV 235
            ..|.||:|.      :.....|.|.     :|.||  |:: ||.......|.| .:....|..|:
Mouse   243 LITFSWHRQ------DTKESVGKKSQRSQRVELEI--PTI-RESHAGGYYCTA-DNNYGLIQSAI 297

  Fly   236 VQIDMNFAPLNIRLLGAHQP---LSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKTTETTSSDG 297
            |.|.:....|| .||....|   ...|...:|.|:...:.||.:..::...|.|   ..|::..|
Mouse   298 VNITVKIPVLN-PLLSISVPGVLPFIGDVAELHCEDKRASPPVLYWFYHENITL---ANTSAPFG 358

  Fly   298 NQTTSTLSISLSKSDAGKYLSCKAYN 323
            .:  ::..:||:...:|.| ||:|.|
Mouse   359 GK--ASFKLSLTAGHSGNY-SCEAEN 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 18/109 (17%)
V-set 32..134 CDD:284989 18/109 (17%)
IGc2 160..>214 CDD:197706 18/59 (31%)
Ig 262..328 CDD:299845 16/63 (25%)
IG_like 264..323 CDD:214653 15/59 (25%)
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
FcrlsNP_109632.2 Ig 19..85 CDD:299845
IG_like 30..84 CDD:214653
Ig_3 111..183 CDD:290638 18/108 (17%)
IG_like 122..190 CDD:214653 18/104 (17%)
Ig_2 223..302 CDD:290606 25/92 (27%)
IG_like 224..302 CDD:214653 25/91 (27%)
Ig_2 311..395 CDD:290606 19/78 (24%)
IG_like 316..395 CDD:214653 18/73 (25%)
SR 402..502 CDD:214555
SRCR 407..503 CDD:278931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.