DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and CD276

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001019907.1 Gene:CD276 HGNCID:19137 Length:534 Species:Homo sapiens

Alignment Length:745 Identity:134/746 (18%)
Similarity:231/746 (31%) Gaps:296/746 (40%)


  Fly    23 VPIHQIESIVGENIYLPCNVTTYDGDE--PVLVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSV 85
            ||...:.::||.:..|.|:.:...|..  .:.::|...|....::|  ...|..:.....:..::
Human    33 VPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHS--FAEGQDQGSAYANRTAL 95

  Fly    86 FGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRV---DFLKAQTINSRIRLNVISPPKQVIIRDSS 147
            |.|    :..:....|.:|..:.:|.|::.|.|   ||..|     .:.|.|.:|    ..:.|.
Human    96 FPD----LLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSA-----AVSLQVAAP----YSKPSM 147

  Fly   148 NVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEIPCELSHLAGGKIIECEITLPSLGR 212
            .:|.:..:.|   ||.|::.|....|||...:.| :||..:|     |.|      .:|...:..
Human   148 TLEPNKDLRP---GDTVTITCSSYQGYPEAEVFW-QDGQGVP-----LTG------NVTTSQMAN 197

  Fly   213 E----DLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRP 273
            |    |::|.|..                           :|||:...|...|..:|.|.|    
Human   198 EQGLFDVHSILRV---------------------------VLGANGTYSCLVRNPVLQQDA---- 231

  Fly   274 PAVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLD 338
                                       .|:::|:..:|..|                     .::
Human   232 ---------------------------HSSVTITPQRSPTG---------------------AVE 248

  Fly   339 IQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNV----FRIEWRHNE-QPLSHNISLG--- 395
            :| |||         ||.....|||....|.....|..    ..:.|:..: :.|.|:.:.|   
Human   249 VQ-VPE---------DPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQ 303

  Fly   396 --------------VIISNHSLVLQGVTRATAGNYSC------VGFNAEGEGISAPFALNILYAP 440
                          :...|.||.||.|..|..|:::|      .|..|....::||:        
Human   304 GSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY-------- 360

  Fly   441 TCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAESIDVATNHIIRSGTTSIVTYTPI 505
                                                   |..|:.:..|..:|.|.|        
Human   361 ---------------------------------------SKPSMTLEPNKDLRPGDT-------- 378

  Fly   506 TELDYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSF 570
                                                            :|:|||.  ..|.|:: 
Human   379 ------------------------------------------------VTITCSS--YRGYPEA- 392

  Fly   571 NLELL--DSYTQEIKANITSTIPKFTVPGL-SPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEK 632
              |:.  |.....:..|:| |.......|| ...|:.|:.:.|..|         .:.::|.|..
Human   393 --EVFWQDGQGVPLTGNVT-TSQMANEQGLFDVHSVLRVVLGANGT---------YSCLVRNPVL 445

  Fly   633 QLTSEQTHNLRAE-LLFSP-VMSLTIGLTLAVLVAVLAIILALRIPCTASSRRRQKELSNENISR 695
            |..:..:..:..: :.|.| .:.:|:||:    |.::|:::||...|.   |:.::....||...
Human   446 QQDAHGSVTITGQPMTFPPEALWVTVGLS----VCLIALLVALAFVCW---RKIKQSCEEENAGA 503

  Fly   696 DESPGPSD---------KSSGSKEVDDCDE 716
            ::..|..:         |.|.||| ||..|
Human   504 EDQDGEGEGSKTALQPLKHSDSKE-DDGQE 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 21/107 (20%)
V-set 32..134 CDD:284989 21/107 (20%)
IGc2 160..>214 CDD:197706 15/58 (26%)
Ig 262..328 CDD:299845 7/66 (11%)
IG_like 264..323 CDD:214653 7/59 (12%)
IGc2 360..425 CDD:197706 20/93 (22%)
Ig_3 456..519 CDD:290638 6/63 (10%)
FN3 538..620 CDD:238020 17/85 (20%)
FAM176 643..741 CDD:291517 22/86 (26%)
CD276NP_001019907.1 IG_like 37..138 CDD:214653 21/112 (19%)
Ig 43..139 CDD:299845 21/107 (20%)
Ig 148..231 CDD:299845 27/125 (22%)
IG_like 156..237 CDD:214653 28/154 (18%)
IG_like 255..356 CDD:214653 21/101 (21%)
Ig 261..357 CDD:299845 20/96 (21%)
Ig 366..449 CDD:299845 24/154 (16%)
IG_like 374..456 CDD:214653 23/153 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.