DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and Skint8

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001093936.2 Gene:Skint8 MGIID:3651523 Length:398 Species:Mus musculus

Alignment Length:251 Identity:60/252 (24%)
Similarity:99/252 (39%) Gaps:58/252 (23%)


  Fly     6 LFMLALQLIESSIGSK-DVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSIDI 69
            ::.|.||::.||...: ..|...:.:.||....|.|.|........:.|.|:|.....|:|    
Mouse    14 VYFLFLQVMASSEKLRVTTPTRHLLARVGGQAELSCQVIPPHSVMHMEVRWFRSGHSQPVY---- 74

  Fly    70 RAGVSKAPKRWSDDSV--FGDRAYFIFDKE---PGKLS--IQNTQASDSGTYRCRVD---FLKAQ 124
               :.:...:.|:::.  :.:|..|:  ||   .||:|  |.|....|.|.|:|..:   |:...
Mouse    75 ---LYRGGHKMSEEAAPEYANRTEFV--KEAIGEGKVSLRIYNINILDDGPYQCSFNDSGFIDVA 134

  Fly   125 TINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRD--GIE 187
            .:|    |||.:...:..|.         |..|.::|  |.::|...|.:|.|.:.| ||  |..
Mouse   135 IMN----LNVTAVGLETEIH---------VQAPDADG--VMVECNTGGWFPRPQMEW-RDSKGAT 183

  Fly   188 IPCE-------------------LSHLAGGKIIECEITLPSLGREDLNSRLTCRAL 224
            :|..                   |::::.|.|| |.|:.|..|.|...|.:....|
Mouse   184 LPHSLKSYSQDEARFFHMKMTLLLTNMSHGSII-CCISNPVTGEEKQTSIILANEL 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 28/112 (25%)
V-set 32..134 CDD:284989 28/112 (25%)
IGc2 160..>214 CDD:197706 20/75 (27%)
Ig 262..328 CDD:299845
IG_like 264..323 CDD:214653
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
Skint8NP_001093936.2 IG_like 35..140 CDD:214653 28/118 (24%)
Ig_MOG_like 42..141 CDD:143190 28/112 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.