DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VII and BTNL2

Sequence 1:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001291490.1 Gene:BTNL2 HGNCID:1142 Length:482 Species:Homo sapiens

Alignment Length:506 Identity:112/507 (22%)
Similarity:169/507 (33%) Gaps:160/507 (32%)


  Fly     7 FMLALQLIESS-----IGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYS 66
            |:..|..::.|     ||    |.|.|.:.|||:..|.|.:........|.|.|||.:..||::.
Human    16 FLFILLTMKQSEDFRVIG----PAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFV 76

  Fly    67 IDIRAGVSKAPKR---------WSDDSVF-GDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVD-- 119
              .|.||.....:         |.::.:. |:.|          |.|.|.|.||:|.|.|...  
Human    77 --HRDGVEVTEMQMEEYRGWVEWIENGIAKGNVA----------LKIHNIQPSDNGQYWCHFQDG 129

  Fly   120 --------FLKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPT 176
                    .||...:.|       :|        |.::|     ||...|  |.|.|...|.:|.
Human   130 NYCGETSLLLKVAGLGS-------AP--------SIHME-----GPGESG--VQLVCTARGWFPE 172

  Fly   177 PTISWYRDGIEIPCELSHLAGGKII----------------ECEITLPSLGREDLNSRLTCRALS 225
            |.:.|           ..:.|.|::                |..:.:.:...|.::..:....|:
Human   173 PQVYW-----------EDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLT 226

  Fly   226 HPRAPIVEAVVQIDMNFAPLNIRLLGAHQPL--SAGRRYDLLC--------QS------AGSRPP 274
            ..:..::....::....|.|.:.  |..||:  ..|....|.|        ||      ...|.|
Human   227 EEKGSVISLPEKLQTELASLKVN--GPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYP 289

  Fly   275 AVITWWQN----GIRLEK---TTETTSSDGNQTTSTLSI-SLSKSDAGKYLSCKAYNHAVPSEPL 331
            ||..:...    |.::.:   .|...|...::...||.| |...||.|:| .|......|..|. 
Human   290 AVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQY-RCLFEKDDVYQEA- 352

  Fly   332 EDGWKLDIQYVPEAYVRLGTSLDPSTLREG-----------TDVYFDCLVMAHPNVFRIEWRHNE 385
                .||::     .|.||:|  |....||           :|.:|     ..|:|   .||..|
Human   353 ----SLDLK-----VVSLGSS--PLITVEGQEDGEMQPMCSSDGWF-----PQPHV---PWRDME 398

  Fly   386 QPLSHNISLGVIISNHSL----VLQGVTRATAGNYSCVGFNAEGEGISAPF 432
            .....:.|..:...:|.|    .|..||..:|.:.:|        .||.||
Human   399 GKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTC--------SISIPF 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 30/122 (25%)
V-set 32..134 CDD:284989 30/122 (25%)
IGc2 160..>214 CDD:197706 12/70 (17%)
Ig 262..328 CDD:299845 21/88 (24%)
IG_like 264..323 CDD:214653 20/81 (25%)
IGc2 360..425 CDD:197706 17/80 (21%)
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
BTNL2NP_001291490.1 IG_like 37..141 CDD:214653 30/116 (26%)
Ig_MOG_like 43..142 CDD:143190 28/111 (25%)
Ig 148..229 CDD:299845 18/107 (17%)
IG_like 252..358 CDD:214653 27/117 (23%)
Ig_MOG_like 260..358 CDD:143190 25/109 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.